SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055186 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055186
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-38
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 119-227
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-35
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 230-344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055186   Gene: ENSBTAG00000020036   Transcript: ENSBTAT00000062971
Sequence length 514
Comment pep:known_by_projection chromosome:UMD3.1:3:92654984:92666926:1 gene:ENSBTAG00000020036 transcript:ENSBTAT00000062971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVKCGGVLSAPSGNFSSPNFPSLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCGFD
FLEIYNGASGDQGNLLGRFCGRVPPPPFTSSWHVMSVVFHSDKHVASRGFSAAYQKDVCG
GVLTGLSGVLASPEYPNNYPNNVECRWVIRAAGPATIKLVFVDFQVEGSEQCTYDYVAVL
GGPGPAREHHYCGSARPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYTAVRG
NFSSPQYPSSYPNNIRCHWTIRLPPGYRVKVFFLDLELEEPNSLTRTCDFDHLAAFDGAS
EEAPLLGTWCGHHLPPPVTSSHNQLLIVLHTDRSTTHRGFSVAYIGVVPMNVSCTRTDFQ
ILISAQALAPLERTKVYLGSRSCAAQEMGSNFRIQARFDTCGTESQRRNNTSVIVSVLYI
DFSAGGQEDTHEYEVRCEPRRKEASAHLLSGSHWLGPYAATAEHLQEAPPRDEVEALEGP
VAMVAQDTSDIVFLGLCILAGVLMVIAIVVLMLL
Download sequence
Identical sequences G3N031
ENSBTAP00000055186 ENSBTAP00000055186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]