SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055280 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055280
Domain Number 1 Region: 144-260
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.54e-26
Family Thyroglobulin type-1 domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 30-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-19
Family Growth factor receptor domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055280   Gene: ENSBTAG00000046768   Transcript: ENSBTAT00000064194
Sequence length 263
Comment pep:known chromosome:UMD3.1:4:76720883:76725301:-1 gene:ENSBTAG00000046768 transcript:ENSBTAT00000064194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEVLAVRAWPLLLSLAVQLGATVGAPQPWRCAPCSAERMALCPPVPASCPELTRSAGCG
CCPMCALPLGAACGVATARCARGLSCRALPGEPRPLHALTRGQGACMTTPSDEATDTKDT
TSPENVSPESSEITQEQLLDNFHLMAESSEDLPILWNAISNYESLRALEISDVKKWKEPC
QRELYKVLDRLAREQQKAGDKLYKFYLPNCNKNGFYHSKQCETSLEGEPGLCWCVYPWSG
KRILGSVAVRGDPKCQQYFNLQN
Download sequence
Identical sequences P24591
NP_776979.2.59421 NP_776979.2.76553 ENSBTAP00000055280 ENSBTAP00000055280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]