SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055281 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055281
Domain Number 1 Region: 269-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-20
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 1060-1106
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 7.06e-16
Family Nuclear receptor coactivator interlocking domain 0.00013
Further Details:      
 
Domain Number 3 Region: 129-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000406
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 24-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055281   Gene: ENSBTAG00000015007   Transcript: ENSBTAT00000064008
Sequence length 1363
Comment pep:known_by_projection chromosome:UMD3.1:11:74511607:74590933:-1 gene:ENSBTAG00000015007 transcript:ENSBTAT00000064008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFNMSGLGDSSSDPANPDSHKRKGSPCDTLASRCVCCNSTEKRRREQENKYLEELAELLS
ANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKES
LGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKN
LLPKSLVNGVPWPQEATRQNSHTFNCRMLIHRPDEPGPENQEACQRYEVMQCFTVSQPKS
IQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDL
VRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQS
PDMQPFIMGIHIIDREHSGLSPQDDTNPGMSVPRVNPSVNPSISPAHGVARSSTLPPSNS
NMVPTRVNRQQSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPPLNLNNSPME
GTGISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIP
VTPLQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQ
SDNSSNDSKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEV
LSCTGTSTSASTNSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSAST
SVSVTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEK
KEQMDPCNTNPASMTKPAPEEIKLESQSQLSKKVDVSFDKVIVHIFVDFRKNTFPAPSSH
LSIHTQFMYFKGTTCFLVSFRDTLNSIFPVHEDRAIILFSPVSVIDTTWPKEDVGMWISM
GKSLKCKGHAAILNIQELYTVNCNDQNERNKEKRKEKRTKDWRNPHTHFGRFPGQNSHTE
SCPHHFNPMGRRQRVPNSLFSTPTSAASLQQRRKSVSKRSPKMLNIRLPELELEAIDNQF
GQPGTGDQIPWANNTVTAVNQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFL
SGKDETELAELDRALGIDKLVQQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPS
PTANLSSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQ
QRLQGQQQLIHQNRQAILNQFAANAPVGINMRSGMQQQITPQNYFFFFLISQPRTQKLGS
SFKPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNSLPPSSGLPVQMGNPR
LPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAPLANR
Download sequence
Identical sequences G3N0C2
ENSBTAP00000055281 ENSBTAP00000055281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]