SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055305 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055305
Domain Number 1 Region: 128-308
Classification Level Classification E-value
Superfamily MIR domain 7.85e-48
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 994-1085
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-18
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 574-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000115
Family SPRY domain 0.065
Further Details:      
 
Domain Number 4 Region: 3935-4013
Classification Level Classification E-value
Superfamily EF-hand 0.00000000855
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 5 Region: 1343-1471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000253
Family SPRY domain 0.019
Further Details:      
 
Domain Number 6 Region: 349-464
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000103
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 7 Region: 2074-2139
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000706
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 8 Region: 12-93
Classification Level Classification E-value
Superfamily MIR domain 0.0000112
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055305   Gene: ENSBTAG00000025642   Transcript: ENSBTAT00000064357
Sequence length 4469
Comment pep:known_by_projection chromosome:UMD3.1:10:28808917:29100901:-1 gene:ENSBTAG00000025642 transcript:ENSBTAT00000064357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTI
HPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGNIQVDASFMQTLWNVHPTCSGSS
IEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRIYYEAGGAGTRARSLWRVEPLRIS
WSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQDRGKSDTKSTAFSFRASKEIKEKLDS
SHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKAQDAKTSRLGPLKRKVILHQEGHMD
DGLTLQRCQREESQAARIIRNTTALFSQFVRYGVDSFIGNSRTAAPVTLPIEEVLQTLHD
LIAYFQPPEEGMQHEGKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNIYNSIAHFAGIA
REESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSGILEVLHCI
LIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCDGVAVRANQNLICDNLLP
RRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWA
SSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLKSDDVVSCC
LDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPSG
YAPCYEALLPKEKMRLEPVKEYKRDAEGIRDLLGTTQFLSQASFIPCPIDTSQVVLPPHL
EKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTE
TLKTLLALGCHIAHVNPAAEDDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEVLVDK
LAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYSLLDERTKKSNRDSLREAVRTFV
GYGYNIEPSDQELADPAVEKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMRVGWAR
PGCRPDIELGADDQAFVFEGSRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMIFTLNG
ELLITNKGSELAFADYEIDNGFVPICSLGLSQIGRMNLGMDASTFKFYTMCGLQEGFEPF
AVNMNRDVAMWFSKRLPTFVNVPKDHPQIEVVRIDGTMDTPPCLKVTHKTFGTQNSSATM
IYCRLSMPVECHSSFSHSPCMDSDAFQKRAEELKHGLSSPQETDNISMASLKWGKEKQLK
GTPVEGERGAEMHVTPSIKLPCNPVIIANQKIGDNNKCAKAQQKAGKQGSQVLASALPLV
QRAGHTPVQSLGSLTPSVVSPQQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKN
CTVTVTLGDERGRVHESVKRSNCYMVWGGDIVATSQRASRSNVDLEIGCLVDLAMGMLSF
SANGRELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPVP
QCPPRLDVQTIQPVLWSRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVD
ILELCEQEDLMRFHYHTLRLYSALCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRS
GFYDLLISIHLASAKERKLMMKNEYIIPITSTTRKIRLYPDESKRHGLPGVGPRTCLKPG
FRFSTPCFITTNEEHQKQSPEIPLELLKTKALGMLTEAVQCSGAHIRDPVGGSVEFQFVP
VLKLIGTLLIMGVFDDDDVRQILLLIDPSVFGEHSGETEEGAEKEEVTQVEEKAVEAGEK
ASREAPIKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQENQKFR
YNELMQALNMSAALTARKTREFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLL
LHCGVPLEEEEEEEEDSSWTGKFCALVQRIKGPPKPEKEQPTEEEERCPTTLKELISQTM
IRWAQEDQIQDAELVRMMFNLLRRQYDSIGELLQALRKTYTISQASVSDTISLLAALGQI
RCLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGAEKLQI
AFPKMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSV
MDNNELALGLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVF
VNSESVEENASVVVKLLIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYK
REVHHFCSTEDDDDEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSIL
RSLVPTEDLVGIISIPLKLPSLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTF
LLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHYTS
LIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYC
KMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKRYDPDLFR
MALPCLSAIAGALPPDYLDTRISATLEKQVSVDADGNFDPKPINTVNFSLPEKLEYIVTK
YAEHSHDRWACDKSQNGWKYGISLDENVKTHPLIRPFKTLTEKEKDIYRWPARESLKTML
AVGWTVERTKEGEALVQQRENEKLRSVSQASQVRPSRPKGNSYSPAPLDLSNVVLSRELQ
GMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFRDREKAQDLFKFLQV
NGIVVSRGMKDMELDASSMEKRFAYKFLKKVLKYVDSAQEFIAHLEAIVSSGKNEKSPHD
QEIKFFAKVLLPLVDQYFINHRLYFLSSPLKPLSSSGYASHKEKEMVASLFCKLAALVRH
RISLFGSDSTTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTLENLKL
GKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQHQFGVDLLLGDVQLSCYHILCSL
YSLGTGKNIYVERQRPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPRERSILGM
PDTVEEMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPEHL
PPSAGPWCTKVTSEHLSVILGNILKIINNNLGIDEASWMKRIADTVYAQPIISKARPDLL
RSHFIPTLEKLKKKAIKTVQEEEQLRADSKGDTQEAELLILDEFAVLCRDLYAFYPMLIR
YVDNNRSNWLKSPDADSDQLFRMVAEIFILWCKSHNFKREEQNFVIQNEINNLAFLTGDS
KSKMSKAMQVKSGGQDQERKKTKRRGDFYSIQTSLIVAALKKMLPIGLNMCTPGDQELIS
LAKSRYSYKDTDEEVKEHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPSNPEKTVERV
QRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHG
YQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEEVEKQPDPLHQIILHFSRNALTERSKL
EDDPLYTSYASMMAKSCQSGEDEDEDEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVL
QMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCR
SVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDF
QNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTK
QIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDL
LQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKE
YDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYIDFVDRFHEPAKDI
GFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISE
SSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADR
PDEEEEEGGDSSYVLEVEGEEEEEEKSFECASAFAMACGSVKRNVANFLKRATLKNLRKQ
YRKVKKMTFKELVKVFFSFFWTLFMGLFHLLFTIVGGIIQVLWSTVFGGGLIEGAKNIRV
TKILGDMPDPTQFGIHDDAMEAERAEVPEPGIATELVHFVKGQKGDADIMSDLFGLHPKK
EGGLKHGPEVGLGDLSEIIGKDETPTLESTVRKKRKAQVSTQAAEMKAAHEAERKIESEK
ADMEDGEKEDTAKEEEQAEALWADVTKRKKRRCGQKVEKPEAFMANFFKGLEIYQTKLLH
YLARNFYNLRFLALFVAFAINFILLFYKV
Download sequence
Identical sequences G3N0E5
ENSBTAP00000055305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]