SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055393 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055393
Domain Number 1 Region: 254-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.78e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000648
Further Details:      
 
Domain Number 2 Region: 152-250
Classification Level Classification E-value
Superfamily LCCL domain 6.15e-26
Family LCCL domain 0.00073
Further Details:      
 
Domain Number 3 Region: 39-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-25
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055393   Gene: ENSBTAG00000047338   Transcript: ENSBTAT00000063169
Sequence length 710
Comment pep:known_by_projection chromosome:UMD3.1:9:33690645:33741475:-1 gene:ENSBTAG00000047338 transcript:ENSBTAT00000063169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGGKKIWAQRLCEVIAIFLICITLVNSPLTFFSFPGDGCGHIVTYKDSGTMTSKNYPWT
YPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTMPKEL
LLNTNEVTVRFESGSHTSGRGFLLTYASSDHPDLITCLDRANHYLKTEYSKFCPAGCRDV
PGDISGNVVDGYRDTSLLCKAAIHAGVIADEVGGQISVFLRKGLSRYEGILANGVLSRDG
SLSDKRFLFTSNGCSGSLSLEPDRQIRASSSWEWINETGDQVRWSPGQARLQDQGPSWAS
GDRSKNHKQREWLRIDLGEKKKITEGIRTTGSTQSDFDFYVKSFVMNFRNNNSKWKTYKG
IVNNEEKVFQGNSNFRDPVRNNFIPPIVARYVRVIPQTWHQRIALKVELLGCQVAPSRTQ
GNDSLVWHKTSVNTVGSTKGEDKTISKPIPSEEMPKGLNITTIVILLVLFFVLAAGVAIF
AVLRKKKKKGNPYGSSKTQKTDCWKQIKYPFARHQSAEFTISYNNEKEMTQKLDLITSDI
ADYQQPLMIGTETVTRKGSTFRPMDTEADAAGPGTEAGGHYDCPLPAGRHEYALPLTNPE
PEYATPIVERHLARAHTFSARSGYRVPGPRPAHKHSLSSGAFSPAAGYQRPPSPAPAEPG
YDQPKGGGLAAGCAPPDHPKPQVSPASSAAYLAPRDCLRPLNPTAMTALL
Download sequence
Identical sequences G3N0M7
ENSBTAP00000055393 ENSBTAP00000055393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]