SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055428 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055428
Domain Number 1 Region: 24-162
Classification Level Classification E-value
Superfamily dUTPase-like 2.49e-45
Family dUTPase-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055428   Gene: ENSBTAG00000047462   Transcript: ENSBTAT00000064252
Sequence length 164
Comment pep:novel chromosome:UMD3.1:X:142679111:142679692:1 gene:ENSBTAG00000047462 transcript:ENSBTAT00000064252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSQEAQVVSPSKWAQATEAGNMRLHFARLSEHATAPTKGSARAVGYDLYSAYDYTVPP
MEKVLVKTDIQIAVPSGCYGRVAPRSGLAAKHFKDVGAGVIDEDYRGNVGVVLFNLGKEK
FEVKKGDQIAQLIRERISYPEIEEVQVLDDTERGSGGFGSTGSN
Download sequence
Identical sequences G3N0R2
ENSBTAP00000055428 ENSBTAP00000055428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]