SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055429 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055429
Domain Number 1 Region: 25-230
Classification Level Classification E-value
Superfamily L domain-like 1.59e-42
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2219-2312
Classification Level Classification E-value
Superfamily Immunoglobulin 7.4e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 2033-2119
Classification Level Classification E-value
Superfamily Immunoglobulin 8.76e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 4 Region: 1532-1626
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 1627-1726
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-20
Family I set domains 0.029
Further Details:      
 
Domain Number 6 Region: 1724-1818
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 2406-2506
Classification Level Classification E-value
Superfamily Immunoglobulin 8.27e-17
Family I set domains 0.0071
Further Details:      
 
Domain Number 8 Region: 584-674
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 1826-1918
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000103
Family I set domains 0.039
Further Details:      
 
Domain Number 10 Region: 488-575
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000055
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Domain Number 11 Region: 1929-2025
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000747
Family I set domains 0.048
Further Details:      
 
Domain Number 12 Region: 2326-2412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000976
Family I set domains 0.039
Further Details:      
 
Domain Number 13 Region: 2138-2217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000149
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055429   Gene: ENSBTAG00000022150   Transcript: ENSBTAT00000064051
Sequence length 2507
Comment pep:known_by_projection chromosome:UMD3.1:X:138878618:138902586:1 gene:ENSBTAG00000022150 transcript:ENSBTAT00000064051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWARWRALSMVLILLWGRPHVALACPHPCACYVPSEVHCTFRSLASVPAGISPHVERIN
LGFNSIQALSETSFTGLTKLELLMIHGNDIPSIPDGALRDLISLQVFKFSYNKLRVITGE
TLQGLWNLVRLHMDHNQIEFIHPEAFRGLTSLRLLHLEGNLLRQLHPATFSTFAFLDYFR
LSTVRHLYLAENAISTLPTGMLQNMPLLENLYLHGNPWACDCDMTWFLQWDAKTKGVLKC
KKDKAYEGGQLCSTCFSPKKWHGQELQKLRDVRCQKPSIESPLRQNRSRSSEDDQDEDEG
ADHPFSPDGFQFPAWNVSVNMSDEHGNTVHLVCDIKKPTDVYRLHLNQTDPQEIEINATV
ALDFECPMTRQNYEKLWKLIAYYSEVPVKLHREPALGKDPRLGYQYRQDADDDSTLYYTG
VRAHVLAEPEWVTQPSIELQLNRRLSSAKLVVLSYSSRHALVMSAKDARLSPSRSWVMIE
PGRAVQRAQTVLEGSACQLSCNVRASESPSISWVLPDGSVVKAPMEDRDGRFSVLTSGWL
KIRSTQPSDAGLYQCIARVRDETDRMLYRVLVQPPVIQPPDAYTVTIQKNPGEPVTLPCQ
ALAVPEAQISWILPNKRMLNAMANASHAYVLADGTLSIPKVQGSDSGYYRCVAVNQRGSD
HFTVGVQVRGRGGIVEDEGGSGMGDEENTSKTVLHPQDQEALIRATDDASGGGKKTRKGR
RKLKPWKHPTKEPETNVAEGRRVFESRRRVNVAKKQINPERWADILARVRGRSLPKGTEG
PQVITVRAPSLMRQEVTSPLPAVAPGSVSPVQTTSSSEESSGDMFVFGEEEQASSAVSSP
RTIPLQPGHDGVVHSEPRVTGTRSEEFIDEDSSEKTVGATPTEVDSNQTPATTLASVLYE
SSTLQTLEMEHKEPTEENVATDSWSTLHVGSVPEATSPEDESPMDAVPLAESETVTYFYP
DLGTNSQPAEKTVKEQASTRFTPTPASWVAEARTSEPLEDPTLGDPSIPVETHLQEQTDS
PQLVETGLSTPGHPLTPEGMKETSQTLQEEGTLETHPTDSRSIKGNGQAVHLTTPLDSTL
EVVNSVTDFQHPRESMPGVVFGKDMTTAPVTTPAQKDTSPSALTTHPSRKRPNGRRRFRP
HKFRHRHKQTPHTTFAPTDAFSPPPTQVPEAKTPSLQVASSLVPTTWVNSAVGTAGRLDT
EEHAESVSRGSPHRKQGKKRNRHRYITSTLSSAASVSKPSFSPEDKHRISFPLSSQAALS
PTTVSFTTGDPREITGMGAYSTASISKTYSASDRFQETVPVTREPASDGQETKNHGVTDL
RDYQTHGLVPGDSVTHAASPSVAEVSPARGFKEVSLTSPFPKTTSWDPPGATQLGVEHTD
PPVTSPSEALTESPSVRESADLEIGPQSRVSTPTPLEEPESPFPPTTLMSSTETTAEPTP
PLPSGTSPAWKASKHHVTFHYVGTPETKAPSVNNEAHQLSTPSSKQDRFTLTPEEALRKE
AFDGSPHSDPLSEHLPHGGLPASKFWTLGEKPQIVTKSPQSVTVTVETDVTFPCEATGKP
KPFVTWTKLSTGRAFTRQAFQTRFEVLKNGTFVIRSVQVQDRGQYVCTAKNLHGADRMVV
LLAVTAQQPQILASHYKDVTVYLGDTIAMECLAKGTPVPQISWVFPDGRVWQTVSPVEGR
VTLHENRTLSIKEASFQDRGVYKCVASNAAGADSLAIRLHVAALPPVIHQEKAENISLPP
GLSIHIHCTARAAPLPSVRWVLRDGTQIRPSQFVHGNLFVFPNGTLYIRNLAPQDSGRYE
CVAANLVGSARRTVQLTVQRAAANARITGTSPQRTDVRYGGTLRLDCSASGDPWPRIVWR
LPSKRMIDALFSFDTRIKAFANGTLVVKSVTDKDAGDYLCVARNKVGDDFVALKVNVVMK
AAKIQHKEANDHRVLYGGDLKVDCLATGLPNPEISWSLPDGSLVNSFMQADDSGGRAKRY
VVFHNGTLYFNEVGPREEGDYTCFAENQVGKDEMRVRVKVVSEPAAIRNKTYSVIHVPYG
DVVTVACEAQGEPTPRVTWLSPTHRLIPASSDKYQVYQDGTLLIQKAQRSDSGNYTCVVR
NSAGEDRKTVWIHVHVQPPTINGYPEAITTVREVAPGGSRKLIDCRAEGVPAPRVLWAFP
EGVVLPAPYYGNRITIHRNGTLDIKSLRMSDSVQLACIGRNEGGEARLVVQLTVLEPLEK
PVFHDPVSEKITAMAGHTISLNCSAAGTPTPTLLWVLPNGTELRSGQRLHRFFHKGDGRL
HISGLSSEDAGAYRCVASNSAGHTERLVSLKVGLKPETNKRYNNLVSIVNGETLRLPCVP
PGARGMRLSWTLPSGVVLDGPQVRGRFALWENGTLTVRDASVFDRGTYVCNADGEHGPSV
VSIPVIVIAYPPRITSEPTPVIYARPGSIVKMNCMAMGIPKAEISWELPDKSHLTAGTQP
RVYGNRFLHPQGSLTVQQATQRDAGFYKCTAKNLLGSDSKTTYVHIY
Download sequence
Identical sequences G3N0R3
ENSBTAP00000055429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]