SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055526 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055526
Domain Number 1 Region: 35-128
Classification Level Classification E-value
Superfamily Immunoglobulin 6.84e-20
Family I set domains 0.0059
Further Details:      
 
Domain Number 2 Region: 140-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000406
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055526   Gene: ENSBTAG00000010689   Transcript: ENSBTAT00000065759
Sequence length 650
Comment pep:known_by_projection chromosome:UMD3.1:7:52714639:52774754:-1 gene:ENSBTAG00000010689 transcript:ENSBTAT00000065759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESKRRGRGRDPKHREGRKRERKQELLPGEEATRPKLKKMKSQTGQVGEKQSLKCEAAA
GNPLPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKLEDAGEYVCEAENILGKDT
VRGRLFVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRC
LEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQ
RKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETETTF
SGSHSCSPSHHCSTATPTSSHRHESHTWSLDRSESLTSDSQSGIVLSSVGTSKCNSPACV
EARARRAAAYSLEERRRAAVPPYHDSIDSLRDSPHSERYVSALTTPARLSPVDFHYSLAT
QVPTFEITSPNSAHAVSLPPAAPINYRLAEQQPLLRQPAPPGPGPGPGPSADMQRSYDSY
YKGPGPRRGACALGGYRGSLPASPFRIPEDDEYETTQECAPPPPPRPRARGASRRTSAGP
RRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDDADDADGALAAESTPFLGLRA
AHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPLPRGKQDSGPL
Download sequence
Identical sequences G3N104
ENSBTAP00000055526 ENSBTAP00000055526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]