SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055569 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055569
Domain Number 1 Region: 127-274
Classification Level Classification E-value
Superfamily L domain-like 1.7e-24
Family Internalin LRR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055569   Gene: ENSBTAG00000004192   Transcript: ENSBTAT00000063561
Sequence length 674
Comment pep:known_by_projection chromosome:UMD3.1:17:55423458:55438850:-1 gene:ENSBTAG00000004192 transcript:ENSBTAT00000063561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGERASMEPETRTLSAAVREHLRQLCLHEFPCGTGSWNKSRFLPQTSRVWRELIPREEKS
LSPGEETVEDLLGLVRSAHSPWALVEGSSAEDLFLKELAIQNPLMLKDSFFYTYFRSLRV
VDKDVSLVDKELLKFVKLEELVLSANQIKEIDTTNLPPTLKVLELYGNKIASMECLCRHP
PPRLQHLGLGHNKLLGPLESLHVTSDHWPNLVSLDLSFNNLTDLQNMVAGLQTLKHLRLL
LLQGNPLALVPHYRGFTIDSLARLCVLDDITVASSEKHLFRGLSRSEDLLAPEAQLLVTV
GNLRGVLDSSVLDSEPGPQGPFITYNYYVTYDFVEDEEGEGSQYGGVLAEVFTPNTELSE
ESRLAASCPLRPCVSLLHIHQAQAPIRTVCVSCRIIKPPSSLEQLGEDILEEIIEDVEES
LESGLASLSELGEMEESIVSGASEPLPRSTDSAEELAKLRPLLDPRLCPSPGTVLFSTVP
KPWSDVIPCNYEMQHTLKDLVPLKAFLLSGTVVTVVEEKILSWPVEQPSSSDSPLAAKKG
KGEKDKKEKEKDKKDKAQKGSKKQKELPKELRQDPPILRVLGSSPVVLEPLLAGEPFVST
VCNFGVIRTLRNLLCGSLSQDAKKNKKGKKVKMSSKKAFTMYENDYQPEPLTVEIQIQLI
QWRSTEEALRGLVM
Download sequence
Identical sequences G3N144
ENSBTAP00000055569 ENSBTAP00000055569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]