SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055599 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055599
Domain Number 1 Region: 430-497
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000022
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 143-203
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000146
Family VWC domain 0.0026
Further Details:      
 
Domain Number 3 Region: 1099-1160
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family VWC domain 0.014
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000418
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 547-612
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000251
Family VWC domain 0.011
Further Details:      
 
Domain Number 6 Region: 725-791
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000272
Family VWC domain 0.012
Further Details:      
 
Domain Number 7 Region: 902-967
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000523
Family VWC domain 0.0063
Further Details:      
 
Domain Number 8 Region: 844-909
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.017
Further Details:      
 
Domain Number 9 Region: 205-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000303
Family VWC domain 0.024
Further Details:      
 
Domain Number 10 Region: 961-1036
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000544
Family VWC domain 0.01
Further Details:      
 
Domain Number 11 Region: 376-437
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000575
Family VWC domain 0.0033
Further Details:      
 
Domain Number 12 Region: 784-838
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000659
Family Fibronectin type I module 0.086
Further Details:      
 
Domain Number 13 Region: 315-377
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000795
Family VWC domain 0.038
Further Details:      
 
Domain Number 14 Region: 668-722
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family VWC domain 0.081
Further Details:      
 
Domain Number 15 Region: 489-549
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000481
Family VWC domain 0.032
Further Details:      
 
Domain Number 16 Region: 1429-1494
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000327
Family ATI-like 0.037
Further Details:      
 
Domain Number 17 Region: 1044-1095
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000167
Family VWC domain 0.0077
Further Details:      
 
Domain Number 18 Region: 97-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000879
Family VWC domain 0.051
Further Details:      
 
Domain Number 19 Region: 628-674
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family VWC domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055599   Gene: ENSBTAG00000003449   Transcript: ENSBTAT00000065857
Sequence length 1518
Comment pep:known_by_projection chromosome:UMD3.1:4:93655277:93685724:-1 gene:ENSBTAG00000003449 transcript:ENSBTAT00000065857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAVAVLLSLILQLASRTLAPGTSRGGAISREPLGLADIQDYQSEGPAHSSAPAGVPEE
WWRPLEEQLERLEAEVTELREQNKDLQGRVTQLESCECHPASPQCWGLGRAWPEGARWEP
DACTACVCQDGAANCVPKPGLARCHGCSHNGQAYGNGETFTPDACTICRCLAGTVRCQGP
SCSELNCLESYTPPGECCPVCRPAQGCTENGSHWEHGQEWTTPGDPCRICQCLEGHILCR
QRECASLCPYPARPLPGTCCPVCDGCFLNGRDYRSGEPVGSGDPCSRCRCVNGSVQCEPP
PCPPTPCRHPGRTPGECCPVCDSCEYQGHKYQNQETFQLQESGRCAHCSCQAGEVSCEER
ECPGMPCTLPDSGPEPCSVCVLDEEEFAEGVQWEPDGQPCTTCSCQAGVPVCGTLLCSPA
PCQHPTQPPGACCPSCENCTYHGQVYANGQNFTDADPCHTCHCEDGTVTCSLVNCPPTTC
ARPQRGPSQCCPRCPDCVLEKQVFLDGERFSHPRDPCQECQCREGHAHCQPRLCPRTSCA
HPLPGVCCQNNCNGCAFGGKEYPNGADFPHPSDPCRLCHCLGGTVQCLARRCPPLPCPEP
VLLPRQCCPRCPAAPSGCPRPGGLVPAHHQEYFSPPDDPCRRCLCLDGSVSCRRLPCPPV
PCTHPHQGPCCPSCDGCLYQGKEFTSGERFPSPTARCHICLCWEGSISCEPRACAPAQCP
FPAQGDCCPACDGCEYLGESYLSGQEFPDPREPCNLCTCLGGFVTCGRRPCEPLGCSHPL
TRAGHCCPTCQGCLYHGVTAAPGETLPDPLDPACSLCTCQEGSMRCQKKPCPPALCPRPS
SGPCFCPVCHSCLSQGQEHQDGEEFEGPTGSCERCLCQAGQVSCVRQRCPPLSCPLQVTE
PGSCCPRCRGCLFHGEEHPEGSSWKPPDSPCSSCMCHEGVITCARIQCVTSCAQPHQGPS
DCCPRCSDCEHEGRKYEPGESFQPGADPCEVCVCELQPEGTPSLRCHRRQCPHLAGCPTS
QLLTPGPQQCCPTCAEALSHCTEHLLGSELTPPDPCYSCQCQDLTWLCIHRACPELSCPL
PERYIPPGSCCPMCQAPAPSCAHQGRQVASGERWDVDACTNCSCMAGTVRCQSQRCPPLS
CGPDEAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGDF
SVHVTNDDRGRSGVSWTQEVAVLLGDVAVRLLQDRAVTVDGRPVALPFLQEPLFYVELRG
RTVVLHSQPGLQVLWDGRSQVEVRVPGSYRGHMCGLCGNFNGFAQDDLRDPEELLRSTEA
AFGNSWQVPEGPGPGRPCSKGREVDPCQAAGYRARREANARCAVLKSAPFSRCHAVVPPD
PFFAACVYDLCACGPGSSSDACLCDALEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFV
FDECGPPCPRTCFNKHVPLGELAAHCVRPCIPSCQCPAGLVEHEGHCISPEACPSVLLTG
DQLPSTPRNPSQELQGPT
Download sequence
Identical sequences G3N171
ENSBTAP00000055599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]