SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055611 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055611
Domain Number 1 Region: 20-401
Classification Level Classification E-value
Superfamily L domain-like 8.62e-67
Family Ngr ectodomain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055611   Gene: ENSBTAG00000024340   Transcript: ENSBTAT00000033672
Sequence length 810
Comment pep:known_by_projection chromosome:UMD3.1:4:67651907:67654339:1 gene:ENSBTAG00000024340 transcript:ENSBTAT00000033672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARAVRFLLVVCGCLALPPWAQPVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQD
VLTYSLGGNFISNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQ
ALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGN
LLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLRSLSTLILSANS
LQHLGPRVFQHLSRLGLLSLRGNQLAHLAPEAFWGLEALRELRLEGNRLSQLPVALLEPL
HSLEALDLSGNELSTLHPTVFGRLGRLRELSLRDNALSALSGDIFAASPALYRLDLDGNG
WTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCTDPTSS
VPPIADNKRRPLPTAPGEEVAPPAGALAEELLPQPQPQQRSRVLPGMAWDGAARELLGNR
SALRLSRRGPGLQQPGSNAAAAAGTAPHPLDLLEKPEGARPTPSDPDPAEPTQTATLSYA
PAGDPWQRAAKQRLAAQQQESAAQSDGGVGLPPLVSDPCDFNKFILCNLTVEAVGADSAS
VRWAVRKHRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPERSDSATLRELRGDTPYLVCV
EGVLGGRVCPVAPRDHCAGLVTLPEPGSQGGVDYQLLTLALLAANALLVLLALAAWASRW
LRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTVCALSEADLIE
FPCGRFMDSGGGGAGGSLRREDHLLQRFAD
Download sequence
Identical sequences G3N181
XP_005200031.1.59421 XP_005205601.1.76553 ENSBTAP00000055611 ENSBTAP00000055611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]