SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055656 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055656
Domain Number 1 Region: 302-430
Classification Level Classification E-value
Superfamily TIMP-like 1.73e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.029
Further Details:      
 
Domain Number 2 Region: 177-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.086
Further Details:      
 
Domain Number 3 Region: 232-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055656   Gene: ENSBTAG00000044132   Transcript: ENSBTAT00000063836
Sequence length 446
Comment pep:known_by_projection chromosome:UMD3.1:18:55745678:55751319:-1 gene:ENSBTAG00000044132 transcript:ENSBTAT00000063836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDFACVLSPLAYVLASAGTMPVTFALWLLLSQASADPCYHPGGRPRFCLPPVTQLAGMA
ASCPQACGPSPGVDLGPRAPCNGSLTLGLGGPFLLSSVSLRFCTPGPPALVLSAAWATGG
PWRSLWRRPAWPGVLGGPERVIFRVPAGPKASVVASHLRLELGGRGGLAAAGVRGRCQCH
GHAARCAARDRPPRCRCRHHTTGPGCESCQPSHRDWPWRPATPRHPHPCLPCQCHPIGAT
GGACNQTNGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRILEATTTLATTPHAYSSDP
QCQNYCNTSDTRIHMSLQRYCQQDYVLHAQVLASEAADTTWQRLAVRVLAVYKQGAQPVR
RGSQAAWVPRADLTCGCLRLRPASHYLLLGRTAGGPDPTRLVLDRHGLALPWRPRWARPL
RRLQQEERAGGCRTLRPSTLSPEPRL
Download sequence
Identical sequences G5E6L9
ENSBTAP00000055656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]