SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055758 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055758
Domain Number 1 Region: 25-220
Classification Level Classification E-value
Superfamily L domain-like 2.45e-39
Family Leucine rich effector protein YopM 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055758   Gene: ENSBTAG00000047786   Transcript: ENSBTAT00000065621
Sequence length 292
Comment pep:known_by_projection chromosome:UMD3.1:29:40674002:40676155:1 gene:ENSBTAG00000047786 transcript:ENSBTAT00000065621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIAESTPDELPSDAEEQLRNGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELP
EEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGSNRLLALPADFAQLQSLRCLWI
EGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLR
MGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAER
DEPTPRPPPRRPARVFDDEEEEDLLIGGGSSQALGAPGDSLRALEAAPGLGT
Download sequence
Identical sequences G3N1L1
ENSBTAP00000055758 ENSBTAP00000055758 NP_001191757.1.59421 NP_001191757.1.76553 XP_019810922.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]