SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055786
Domain Number 1 Region: 173-287,407-553
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.99e-66
Family Phosphate binding protein-like 0.00000000125
Further Details:      
 
Domain Number 2 Region: 7-161
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-24
Family L-arabinose binding protein-like 0.02
Further Details:      
 
Domain Number 3 Region: 304-406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000106
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055786   Gene: ENSBTAG00000006176   Transcript: ENSBTAT00000063398
Sequence length 660
Comment pep:known chromosome:UMD3.1:15:2044580:2138300:-1 gene:ENSBTAG00000006176 transcript:ENSBTAT00000063398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTY
DGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQGLTGNVQ
FDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTI
MESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIW
NGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDP
LAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFS
LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA
KQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKF
AFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLD
KLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRA
EAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTTIRQSSGLAVIASDLP
Download sequence
Identical sequences G3N1N5
ENSBTAP00000055786 ENSBTAP00000055786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]