SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055790 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055790
Domain Number 1 Region: 1222-1398
Classification Level Classification E-value
Superfamily AbfB domain 4.05e-21
Family AbfB domain 0.02
Further Details:      
 
Domain Number 2 Region: 886-950
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000036
Family ATI-like 0.03
Further Details:      
 
Domain Number 3 Region: 780-846
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000018
Family BSTI 0.033
Further Details:      
 
Domain Number 4 Region: 2379-2442
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000392
Family BSTI 0.041
Further Details:      
 
Domain Number 5 Region: 426-476
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000196
Family ATI-like 0.084
Further Details:      
 
Domain Number 6 Region: 949-989
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000816
Family VWC domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055790   Gene: ENSBTAG00000000987   Transcript: ENSBTAT00000064728
Sequence length 2933
Comment pep:known_by_projection chromosome:UMD3.1:15:35409567:35496594:-1 gene:ENSBTAG00000000987 transcript:ENSBTAT00000064728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPAPVFCLLLACVWLPRGEPAGEFPPLQSLGERGKETPRRGRKDLRRLQGERMGVMQA
CFSPSHSHQEAVLAIGDATTVMGGQEEAEVLDSLAMSSWERRLHRAKCAPSYLFSCFNGG
ECVHPAFCDCRRFNATGLRCQMVYNAGPERDSICRAWGQHHVETFDGLYYYLSGKGSYTL
VGHHEPEGQIFSVQVHNDPQCGSFPYTCSRSVSLFFAGEQEIHLAKEVTRGGVRLQLPHV
MGNLRLQLLAGYVLVRLQSAFTLAWDGTSAVYIKMSPEFLGWTHGLCGNNNADPQDDLVT
SYGKLTDDVAEFVHSWQEQAPNQPPGPTTSSLPRPPCLQQTPGTMQGVYDRCEALLRPPF
DTCHAYVSPLPFMASCTSDLCQSAGDEATWCRALAEYARACAQAGRPLQGWRNQLQSCTV
LCKEKAFVYNECVACCPASCQPRASCVDSEIACVDGCYCPDGLIFEDGGCVAPAECPCEF
HGTLYPTGSVVKEDCNSCTCTAGRWVCSTSVCPAECSVTGDIHFTTFDGRRYTFPATCQY
ILAKSRSSGTFTVMLQNAPCGLNQDGVCVQSVSVILHQDPRRQVTLTQAGDVLLFDQYKV
TPPYTDDAFEIRRLSSVFLRVRTNVGVRVLYDREGLRLYLQVDQRWVEDTVGLCGTFNGN
TQDDFLSPVGVPESTPQLFGNSWKTLSACSPLVSGSRLDPCDVHLQAASFALQACSVLTG
ELFAPCSAYLSPVPYFEQCRRDACRCGQPCLCATLAHYAHLCQRHGLPVDFRARLPGCAL
SCEATKEYSPCVAPCGQTCQDLAGPEACGVDGGSDLRGDECVEGCACPPDTYLDTQADLC
VPRNHCSCHFQGMDYPPGDSDVPTLGHCSCPQVSSLSPPSPLPAAACPAGQVFVNCSDLH
ADPELSRERTCEQQLLNLSVPARGPCLSGCACPQGLLRHGDACFLPEECPCTWKGKEYYP
GDQVMSPCHSCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKSTS
DFSFSVIVENVNCYSSGIICRKFISINVGNSLIIFDDDSGNPSPESFLDEKQQVHTWRAG
FFTLVHFPREHITLLWDQRTTVHVQAGPQWQGQLAGLCGNFDLKTVNEMRTPENLELTNP
QEFGGSWAAVECPDTLDPRDTCVLNPLREPFAKKECSVLLSEVFETCHPVVDVSWFYSNC
LTDTCGCSRGGDCECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCDFFNKALGKGPYQL
ASLAAGGALVAMKVAGGALVLVRAEDVAPGDIVNFLLTAALYKAKAHDPDVVSLEAADRP
NFFLHVTANGSLELAKWQADDAFRHHASFSLHRGTWRAGLVALESLAEPGAFLYVSGPVL
ALRPYEHTEAFRWGTLFRLLDAKPSGAAYPTCEWHYDACASPCFQTCRDPWAAGCRDVPR
VEGCVPACATPKVLDEVTQRCVHLEDCVEPVDLVPREALGNETLPPGQALPTASDREPQF
PQEAPGASSHRPALTPTAPLTTALNPPTAATVGPALSPGPAQATQQQLLGVTASNLPEHP
TEAPASKGVTAGHPASSGAPEPSSLPVSQHVPTSGMGSGAMETTRVTVILAESPNITVSS
LSPPAPRFPLMTKAVTVLGLGSLPVKTTPLQPFPSLELPASPSPAVTSRPPTSSGAREAS
LTPAMTKVMTETGVPQSIQAQGPSSPSSPPAEARTAAEKIPAHTLVTESVETVPSPEKVQ
PGPDQPTGLPAAPLPSPLPMASARPAQHATTAARPPAQPSGTAAAASLSTVAHSLGATPF
TTLESTRPAQLLSGLPPDTSLPLAKVGTSAPVATPGPKGSTLTPPLQQQATSLAVATTLP
AGTLSPAPPLTLAVVAQGHQPGHAVPQATGTAPGLLLGATLPTPGVVAVAEGVASTVSAA
PRKSTTEKTVILSKQVSLPTWISGSAQGRPTELMPAVAHTAATLVMGAEGPWAGTVPLVP
TSYPLSQVSARTASRESPLILPPQLAEAHGTSAGPQPPAEPEGEATTQQSGRSAPAVQSV
SAGSAEALAITAEAKTPAACVPIAEQDCVRHICLQGELIRVNQSQHCPQGAAPPRCGVLG
LAVRVGGDRCCPIWECACRCSIFPDLSFVTFDGSHVALFKEAIYILSQRPEEMVTVHVLD
CKSANLGHLNWPPFCLVMLTVTHKTHEVTIDRFNRKVSVDSQPAWPPVSWHGFRIEDTGH
MYVIRTPSHIQIQWLHSSGLMILEASRASEAQGRGLCGICDGDVANDLTLKDGSVVSEAE
DPAPFLDSWQVPSSLTSVGQTRFRPDSCATADCSPCLRMVSNRTFSACHRFVPPESFCDL
WIRDTKYVQQPCVALTVYVAMCHKFHVCIEWRRSDHCPFLCSSDSTYQACVSACEPAKTC
QDGMLGPLDPEQCQVLGEGCVCSEGTILHRRHSGLCIPEEKCACTDSTGMPRALGETWNS
SLSGCCQHQCQAPDTIVPVDLGCPGPRPESCPRFGEVALLQPTEDPCCLGTVCVCNQTLC
EGLAPTCSPGHRLLTHFQEDSCCPSYSCECDPDLCEAVQVPSCRQDQILITGRLGDSCCI
SYLCACGDCPDPIPECQEGEALTVDRNTTELCCPLYQCVCESFRCAHVQCGMGTALVEVW
SPERCCPYKSCECDCDTIPVPRCHLWEKSQLDEAFMRSAENVCGCAKYECVKAPVCLSRE
LGVMQPGQTVVELSADGVCHTSRCTDVLDPLTSFYQINTTSVLCDVHCEANQEYEHPRDL
AACCGSCRNVSCLFTFPNGTTSLFLPGASWIADCTRHHCSSTPLGAVLVRSPISCPPLNE
TECAKVGGSVVPSLEGCCRTCKEDGRSCKKVTIRMTIRKNECRSNTPVNLVSCDGRCPSA
SIYNYNINTYARFCKCCREVGLQRRSVQLFCATNATWVPYTLQEPTDCACQWS
Download sequence
Identical sequences G3N1N9
ENSBTAP00000055790 ENSBTAP00000055790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]