SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055795 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055795
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.83e-82
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 317-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-21
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 438-544
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055795   Gene: ENSBTAG00000037921   Transcript: ENSBTAT00000063712
Sequence length 562
Comment pep:known_by_projection chromosome:UMD3.1:15:45601855:45623620:1 gene:ENSBTAG00000037921 transcript:ENSBTAT00000063712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHISKKKLILLFGIIFLEQSKSATLSLPKVSTCGQSPVKSQPLNYLNIFSRIVGGRQVAK
GSYPWQVSLKQRQKHVCGGTIISPQWVITAAHCVANRNTVSTFNVTAGEYDLRYVEPGEQ
TLTIETIIIHPHFSTKKPMDYDIALLKMAGAFRFDQFVGPMCLPEPGERFKPGFICTTAG
WGRLSENGISPQVLQEVNLPILTQDECITALLTLEKPISGRTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGTWTMAGVTSWGLGCGRGWKNNLQKDDQGSPGIFTDLTKVLSWIHKHIRI
GNQAKTSRATCSEQDRVVRALEGDLHFPESPFLYYESKQQCAWTLLVPEEMHVLLSFSHF
DAESCDHNYLSIYSLEDTLIAKFCGERLASSVLVGSNAIRLSFISDNTDNAVGFNLTYKA
VKPNYLPDGNCNIFSLIIEKRGMANSLNFPHKYRDYRSPVWEISGLKKILIKLSFQDLKI
EENGDCTSDYVSVHRDVERKKEIARLCGFAVPTPVVSITRVMSISFQSNENANFRGFQAT
VSFVHETGKRTEVPTLSLILLM
Download sequence
Identical sequences G3N1P3
ENSBTAP00000055795 ENSBTAP00000055795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]