SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055797 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055797
Domain Number 1 Region: 69-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-57
Family SPRY domain 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055797   Gene: ENSBTAG00000046116   Transcript: ENSBTAT00000063227
Sequence length 246
Comment pep:novel chromosome:UMD3.1:23:26688281:26690021:1 gene:ENSBTAG00000046116 transcript:ENSBTAT00000063227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIIQDRKRKPKGFKTRKGIKKTEKENNSKRNLVRKKKVKGFLFCSFAAWRNVPLYPGSH
VHLSLVDWRKEEFKAVNMTLDAATAHPALLLSEEGRQVSWQERCQEIPSSSERFSSIPCV
LGQLCIISGRYSWDIEVGDACSWDLGVCRDNVTRKGRVTMSPKNGFWAIRFYEGEYWALT
SPETPLILREKPVIVRVFLDYESGDVSFYNMTDESHIFTFPQNPFYGVLKPLFRLWSSES
GSLTIC
Download sequence
Identical sequences G3N1P5
ENSBTAP00000055797 ENSBTAP00000055797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]