SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055806 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055806
Domain Number 1 Region: 341-449
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 565-677
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 4 Region: 208-315
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0056
Further Details:      
 
Domain Number 5 Region: 448-552
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 6 Region: 105-208
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055806   Gene: ENSBTAG00000039470   Transcript: ENSBTAT00000065731
Sequence length 806
Comment pep:novel chromosome:UMD3.1:5:103132709:103149919:-1 gene:ENSBTAG00000039470 transcript:ENSBTAT00000065731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRLVDGGGPCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLGCGEALNAMGSAHFGAG
SGPIWLDTLGCRGKESHVWKCPSRGWGLHNCSHDNDAGVVCSGFVRLVGDDGPCSGRVEV
RPGEDWTPVSDGNFTLPTAQVICAELGCGEAVSVLGHELFRESDGQVWAEEFRCEGKERK
LWWCPRVPCPGGTCHHSGAAQVVCSAYSEVRLMTNGSSQCEGQVEMKISGRWRALCASHW
SLANANVVCRQLGCGVAISTPRGPHLVERGDQISTVRFHCSGAESFLWSCPVTALGGPDC
SHGNTASVTCSGNQTRVLPQCNDSVSEPAGSVASEESAPYCLDSRQLRLVDGGGPCAGRV
EILDQGSWGTICDDGWDLDDARVVCRQLGCGEALNATRSAHFGEGPGPIWLDDLNCTGKE
SHVWRCPSRGWGRHDCRHKEDAGVICSEFLALRMVSGDQECAGWLEVFYNGTWGSVCRSP
MDDVTVSIICSQLGCGDSGSLNTSVGLREGSRPHWVDGIQCQRTDPSLWQCPSDPWNYNS
CFPKEEAYISCAVRRPKSCPTAASCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDSW
SLAEAEVVCQQLGCGQALEAVQAATFGPGNGSIWLDEVRCGGRESSLWDCAAEPWGQSDC
KHKEDAGVRCSGVRTTLPMTTAALSSYEDTLAEAVYEELDYLLTQKEGLGSPDQRTDVPA
ENYDDAEEVPVPGTPSPSQGSEEEVSPEKEDGVRSSQTGSCLNFSREAADPGEGEESFWL
LQGKKGDAGYDDVELSALGTSPVTFS
Download sequence
Identical sequences G3N1Q3
ENSBTAP00000055806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]