SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055851 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055851
Domain Number 1 Region: 186-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-48
Family SPRY domain 0.0000757
Further Details:      
 
Domain Number 2 Region: 6-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000168
Family C1 set domains (antibody constant domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055851   Gene: ENSBTAG00000048304   Transcript: ENSBTAT00000063275
Sequence length 363
Comment pep:novel chromosome:UMD3.1:23:26932957:26938287:1 gene:ENSBTAG00000048304 transcript:ENSBTAT00000063275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPAGVGSAPQVRITGPEEDGVRVVCTASGWFPKPQVQWRDLSGEKFLAFSEAHTQDAEG
LFSVEAALVVRDSSVGNVTCSILNPVLGQEKAMAIFIPEPFFPQASPWKVAFSVSLTVLV
ILLLGAGCYTKREHSMKMQEMGEKETLCQTSEQDRQTKEEVLKDAAWRKAQLYAGHGQGS
GIQNYWRKEEFQEWPVTLDPGSAHSDLVVSHEKTSVTLKASCVNTADTCSVLGFEGITSG
RCYWEVEIRDGDQSEWALGVCGEGVNRKGLYIESPHKGFWTVGRFERGYCACTVPQTLLS
LMQAPHPRLRVGVFLDHQEGDISFYNMTDGSHIFSFPQASFSGTLFPYFMIRYGDVSMTI
CSK
Download sequence
Identical sequences G3N1U8
ENSBTAP00000055851 ENSBTAP00000055851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]