SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055913 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055913
Domain Number 1 Region: 79-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-57
Family SPRY domain 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055913   Gene: ENSBTAG00000047420   Transcript: ENSBTAT00000064130
Sequence length 291
Comment pep:known chromosome:UMD3.1:7:41643902:41650567:-1 gene:ENSBTAG00000047420 transcript:ENSBTAT00000064130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVFLPGTSPWKRAFLGTLVGLPLLLALLMMLVLYFFRKQRKSQEKLKKQAERDKGKLTVE
LGKLQVELDWRRAEGQAEWRAAQRHAVDVTLDPGSAHPSLEVSEDGKSVSSLRTAPGSEN
PQWLSEQTCVLSRELFSTGRHYWEVHVGRRSRWFLGVCLAAVPRAGHARMSPATGYWVMG
LWNSCEYFVLDQHRVPLSVRVPPRCVGIFLDIEAGKLSFFNVSDGSHIFTFTDTFPGMLC
AYFRPRAHDGSEHPDPLTICPLPVGEKHVLEEEDSDAWLQPYESSNTDLGL
Download sequence
Identical sequences G3N208
ENSBTAP00000055913 ENSBTAP00000055913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]