SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055995 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055995
Domain Number 1 Region: 122-269
Classification Level Classification E-value
Superfamily L domain-like 1.29e-24
Family Internalin LRR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055995   Gene: ENSBTAG00000004192   Transcript: ENSBTAT00000063215
Sequence length 635
Comment pep:known_by_projection chromosome:UMD3.1:17:55423458:55438835:-1 gene:ENSBTAG00000004192 transcript:ENSBTAT00000063215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMEPETRTLSAAVREHLRQLCLHEFPCGTGSWNKSRFLPQTSRVWRELIPREEKSLSPGE
ETVEDLLGLVRSAHSPWALVEGSSAEDLFLKELAIQNPLMLKDSFFYTYFRSLRVVDKDV
SLVDKELLKFVKLEELVLSANQIKEIDTTNLPPTLKVLELYGNKIASMECLCRHPPPRLQ
HLGLGHNKLLGPLESLHVTSDHWPNLVSLDLSFNNLTDLQNMVAGLQTLKHLRLLLLQGN
PLALVPHYRGFTIDSLARLCVLDDITVASSEKHLFRGLSRSEDLLAPEAQLLVTVGNLRG
VLDSSVLDSEPGPQGPFITYNYYVTYDFVEDEEGEGSQYGGVLAEIIKPPSSLEQLGEDI
LEEIIEDVEESLESGLASLSELGEMEESIVSGASEPLPRSTDSAEELAKLRPLLDPRLCP
SPGTVLFSTVPKPWSDVIPCNYEMQHTLKDLVPLKAFLLSGTVVTVVEEKILSWPVEQPS
SSDSPLAAKKGKGEKDKKEKEKDKKDKAGKGEKEPPKAQKGSKKQKELPKELRQDPPILR
VLGSSPVVLEPLLAGEPFVSTVCNFGVIRTLLCSVLVVAKSHLKKKKEALKKMSSKKAFI
SVYENDYQPEPLTVEIQIQLIQWRSTEEALRGLVM
Download sequence
Identical sequences G3N285
ENSBTAP00000055995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]