SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056051 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056051
Domain Number 1 Region: 97-250
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-42
Family F-box associated region, FBA 0.0045
Further Details:      
 
Domain Number 2 Region: 12-90
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000641
Family F-box domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056051   Gene: ENSBTAG00000046109   Transcript: ENSBTAT00000064304
Sequence length 250
Comment pep:novel chromosome:UMD3.1:26:423899:424648:1 gene:ENSBTAG00000046109 transcript:ENSBTAT00000064304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASTSWGLLSRVPAPHREPQEAPSLNQLPIEMLRNVLSYLPPSTLLWHCRPVCQHWRDL
VDGWDLWRSILPWKHPDLWPVILICLPPADNPRPCILGRFCELRPIGRKLTANTPSKDLW
NCMMLNGSNGSEEEEDLGVRLKTSGETSYSLAYRCWYKGEISDMEEEGLCRELLDSGNIW
ISVCHCWTEQQGSNRMYQVVFKLLDANYAISHYFFHKRFSIRPRTGSFSFRIMHAFTSIK
KGVHFVLFDH
Download sequence
Identical sequences G3N2D9
ENSBTAP00000056051 ENSBTAP00000056051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]