SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056054 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056054
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-39
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056054   Gene: ENSBTAG00000047030   Transcript: ENSBTAT00000064343
Sequence length 138
Comment pep:known chromosome:UMD3.1:18:49552815:49554731:-1 gene:ENSBTAG00000047030 transcript:ENSBTAT00000064343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCLPNPYQQSVSLAVGFMVKIMGNLESSCGKNPELVVDFCTGIEEDSDIAFHFRVYTNS
MVVMNSFQKGGWQEEKRMFSDPFMPGQPFELRFLVLENEYKVFVNNESFCQFAHRLPLQS
VKMLKVKGDTVLTSVDTF
Download sequence
Identical sequences G3N2E2
ENSBTAP00000056054 ENSBTAP00000056054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]