SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056065 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056065
Domain Number 1 Region: 349-527
Classification Level Classification E-value
Superfamily L domain-like 5.44e-28
Family Ngr ectodomain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056065   Gene: ENSBTAG00000015994   Transcript: ENSBTAT00000064516
Sequence length 622
Comment pep:known_by_projection chromosome:UMD3.1:12:16361601:16394987:1 gene:ENSBTAG00000015994 transcript:ENSBTAT00000064516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVLIIKMQKHPQLLRRPLPPNLPKLSLCQKKVHAEHSVKYTKPQEKTTSFERDKTSFPV
VPRDRAQTPVSIQNLFLDHHVQQRVMTISTTRKSSKQVYWHIPETATGSIFFPRCRSASA
RVFGKEISKMEGPEKSEGPLKIQNIYASILKDILILSSEFSRVPSATPSAPSPKLKEVHS
DHFLQESNIYTFKQPLFRLSATVPIPVPRTPVKARQWSDRVRSRTVTLNITDFPGPMLIP
SPVLPRKPLRQSVIGKSNGADAVTGILTLPVWQGQTETAPPTVVMGTRSSLSKPRYHRPE
QISIKSKKIEPTVAPVIQGEGFKTVVATRYETIVAMTNLAIINCQIHGRNALNLKGFFLL
NCPDLTPLAFQLIYLNLSYNNICYFPTEIYCLKHLQILNLRNNPIKEIPSTIQQLKLLKS
LNVAFNLITTLPPGLFCLRYLEELDISYNSIAFIPNDIQKLRSLEKLMVDGNELTSFPHG
ILKLNLKKILFENNFTNPIFWKENSMNDPQHLTQIAALFFLKNNLHKYYNVIPEEIQKLL
KCTSQCEWCHGPMFGEGFRIIRSYDVFGVTQLPVIFYVCSSSCYRKVKESNIVFDHVPEK
RISLNPELMNPTVMYESHFKNH
Download sequence
Identical sequences G3N2F3
ENSBTAP00000056065 ENSBTAP00000056065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]