SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056147 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056147
Domain Number 1 Region: 39-263
Classification Level Classification E-value
Superfamily L domain-like 1.38e-35
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 352-566
Classification Level Classification E-value
Superfamily L domain-like 2.04e-35
Family Ngr ectodomain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056147   Gene: ENSBTAG00000039377   Transcript: ENSBTAT00000057033
Sequence length 844
Comment pep:known_by_projection chromosome:UMD3.1:X:28706984:28709518:-1 gene:ENSBTAG00000039377 transcript:ENSBTAT00000057033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGVWFLSVLTVAGILETESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNN
KLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
VLLTHLDLRGNRLKLMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
IVCETPFRLHGKDVTQLTRQDLCPRKSTGDSAQRGGHTDTHIPRLSPTLNPALNPTRAPK
ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQ
ERKFTNISDLQPKPTSPKKLYLTGNYLQMVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFT
NLTSLRRLYLNGNYLEVLFPAMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNN
NLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGL
KDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDGPNLSDGTVLSMNHNTDTPR
SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKRVPSVPRSANNL
DVSSFQLQYGSYNTETQDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSY
SNLEEKKEEPATLAYTISATELLEKQAPREPELLYQNIAERVKELPSAGLVHYNFCTLPK
RQFTPSYESRRQNQDRINKTVLYGTPRKCFVGQSKADHPLLQAKPQSEPDYLEVLEKQTA
ISQL
Download sequence
Identical sequences G3N2N1
ENSBTAP00000056147 XP_005200652.1.59421 XP_005227636.1.76553 XP_010798644.1.59421 XP_010819784.1.76553 XP_015316947.1.76553 XP_015325702.1.59421 XP_019811876.1.53367 XP_019811877.1.53367 XP_019811878.1.53367 ENSBTAP00000056147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]