SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056258 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056258
Domain Number 1 Region: 141-369
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-53
Family C-terminal domain of adrenodoxin reductase-like 0.00000000218
Further Details:      
 
Domain Number 2 Region: 37-200
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.53e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000267
Further Details:      
 
Domain Number 3 Region: 347-497
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000224
Family N-terminal domain of adrenodoxin reductase-like 0.000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056258   Gene: ENSBTAG00000006525   Transcript: ENSBTAT00000064838
Sequence length 498
Comment pep:known chromosome:UMD3.1:19:57164042:57175524:1 gene:ENSBTAG00000006525 transcript:ENSBTAT00000064838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWPWSSWTRTRLPPSRSIQNFGQHFSTQEQTPQICVVGSGPAGFYTAQHLLKH
HSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTV
QELRDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPDHLEVLLLCQKTDITEAALGALRQSRVKTVWIVGRRGPLQ
VAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEA
ARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPC
GLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTD
SFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASG
KPREKLLDPQEMLRLLGH
Download sequence
Identical sequences G3N2Y7
ENSBTAP00000056258 ENSBTAP00000056258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]