SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056281 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056281
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-40
Family Dual specificity phosphatase-like 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056281   Gene: ENSBTAG00000046467   Transcript: ENSBTAT00000064455
Sequence length 173
Comment pep:known chromosome:UMD3.1:14:3578346:3586015:-1 gene:ENSBTAG00000046467 transcript:ENSBTAT00000064455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVSYKNMRFLITHNPTNATLSSFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKNKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHAHKTKCCIM
Download sequence
Identical sequences A2VDT1
ENSBTAP00000056281 ENSBTAP00000056281 NP_001077235.1.59421 NP_001077235.1.76553 XP_005215180.1.76553 XP_005215181.1.76553 XP_010810118.1.76553 XP_015329814.1.76553 XP_020755711.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]