SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056333 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056333
Domain Number 1 Region: 21-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-45
Family Galectin (animal S-lectin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056333   Gene: ENSBTAG00000046372   Transcript: ENSBTAT00000063723
Sequence length 161
Comment pep:novel chromosome:UMD3.1:19:19641109:19650002:1 gene:ENSBTAG00000046372 transcript:ENSBTAT00000063723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGSGHVGDEDMAFRDTQPPYINPPVPFTGMIEGGLQDGHKITVMGRVLSTGESRFSVN
FQMDHTDHEIAFHFNPRFEEGRYVVCNTKQLGKWGPEERKMQMPFQKGSLFEICFEVESS
AFKVMVNKNIFLYYVHRVPFYQLNAISVKGGVHLSYISFQV
Download sequence
Identical sequences G3N359
ENSBTAP00000056333 ENSBTAP00000056333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]