SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056398 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056398
Domain Number 1 Region: 8-54
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000147
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056398   Gene: ENSBTAG00000047459   Transcript: ENSBTAT00000064889
Sequence length 56
Comment pep:known chromosome:UMD3.1:4:111541950:111542117:1 gene:ENSBTAG00000047459 transcript:ENSBTAT00000064889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNLSEVAQRRPGSFANVSIDMCAIID
Download sequence
Identical sequences G3X8G6
ENSBTAP00000056398 ENSBTAP00000056398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]