SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056432 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056432
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-41
Family Galectin (animal S-lectin) 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056432   Gene: ENSBTAG00000046365   Transcript: ENSBTAT00000063040
Sequence length 139
Comment pep:novel chromosome:UMD3.1:18:48769012:48771241:-1 gene:ENSBTAG00000046365 transcript:ENSBTAT00000063040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSFNVPHKTSLPEGIRVGTVLRIRGLVPDKAGRFYVNLLCGEEPGSDAALHFNPRLDE
STVVFNTLERGTWGAEERGSGIPFQRGQPFDVLLIATEEGFKAVIADSEYHHFRYRIPPG
RVRALEVGGDLQLELVKIF
Download sequence
Identical sequences G3N3D0
ENSBTAP00000056432 XP_002695021.1.76553 XP_010847499.1.44457 XP_015322971.1.59421 ENSBTAP00000056432 9913.ENSBTAP00000042181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]