SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056434 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056434
Domain Number 1 Region: 10-60
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000000000732
Family Ribosomal protein L33p 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056434   Gene: ENSBTAG00000035199   Transcript: ENSBTAT00000049696
Sequence length 65
Comment pep:known chromosome:UMD3.1:13:2891529:2891726:-1 gene:ENSBTAG00000035199 transcript:ENSBTAT00000049696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSAVTFAKSKSKTILVKMVSQAGTGFSFNTKRSRLWEKLTLLHYDPVVKKKVLFVEQK
KIRSL
Download sequence
Identical sequences Q3SZ47
NP_001106779.1.59421 NP_001106779.1.76553 XP_005686928.1.57651 XP_005895816.1.15283 XP_005979029.1.78601 XP_006046201.1.26621 XP_010810412.1.76553 XP_010820999.1.59421 XP_010838964.1.44457 XP_019826055.1.53367 XP_019828965.1.53367 XP_020741938.1.74333 ENSBTAP00000056390 ENSBTAP00000056434 ENSBTAP00000056390 ENSBTAP00000056434 9913.ENSBTAP00000051754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]