SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056453 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056453
Domain Number 1 Region: 55-139
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 137-201
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000072
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056453   Gene: ENSBTAG00000047587   Transcript: ENSBTAT00000064165
Sequence length 207
Comment pep:novel chromosome:UMD3.1:21:26811825:26837752:1 gene:ENSBTAG00000047587 transcript:ENSBTAT00000064165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKP
SFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPD
DVEKLREQLCTSENSMTGQCRSLHEVF
Download sequence
Identical sequences G3N3F0
ENSBTAP00000056453 ENSBTAP00000056453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]