SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056455 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056455
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-27
Family DEP domain 0.0081
Further Details:      
 
Domain Number 2 Region: 222-276
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000994
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000056455
Domain Number - Region: 116-158
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0706
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056455   Gene: ENSBTAG00000017751   Transcript: ENSBTAT00000064334
Sequence length 309
Comment pep:novel chromosome:UMD3.1:19:62614470:62644686:1 gene:ENSBTAG00000017751 transcript:ENSBTAT00000064334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLRKIEALVKDMQDPDTGVRVQNQKVTVVSIPHAMTGSDVLQWIS
QRLWISGLEAQNLGNFIVKYGYIYPLQDPRNLTLKPDSSLYRFQTPYFWPTQQWPAEDVD
YAIYLAKRNIKKKGILEEYEKENYNFLNKKINYKWDFVIMQAREQYRAGKERNKVDRCAL
DCQEKAYWLVHRCPPGQSCIVNYGHRAVSGPSEEQKQTVVSVRKEIMYYRQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLYVFEMSVFFRKNFSHY
NFHVIEFTT
Download sequence
Identical sequences G5E6P2
ENSBTAP00000056455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]