SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056481 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056481
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily L domain-like 2.89e-47
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056481   Gene: ENSBTAG00000046051   Transcript: ENSBTAT00000064825
Sequence length 193
Comment pep:novel chromosome:UMD3.1:1:117680628:117685252:1 gene:ENSBTAG00000046051 transcript:ENSBTAT00000064825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTEVHCTFRYLTSIPESIPPNVERINLGYNSLVRLTEADFSGLNKLELLLLHSNGIHTVP
AKTFSDLQALQVLKMSYNKVRKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLTSLRL
VHLEGNQLTKLHPDTFVSLRYLQYLYLSDNFLSSIPQEMVTYMSDLESLYLHGNPWICDC
QLKWLADWLREKP
Download sequence
Identical sequences G5E6R8
ENSBTAP00000056481 ENSBTAP00000056481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]