SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056494 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056494
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 246-352
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 3 Region: 708-819
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 
Domain Number 4 Region: 141-247
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 5 Region: 589-698
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 6 Region: 461-562
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0063
Further Details:      
 
Domain Number 7 Region: 353-455
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056494   Gene: ENSBTAG00000026531   Transcript: ENSBTAT00000064798
Sequence length 949
Comment pep:known chromosome:UMD3.1:5:103375408:103417370:-1 gene:ENSBTAG00000026531 transcript:ENSBTAT00000064798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSSGNQIQVLPQCNDSLSQPAGSSASEESAPYCSDSRQLRLVDGGGPCAGRVEILDQGS
WGTICDDGWDLDDARVVCRQLGCGEALNATGSAHFGAGSGPIWLDNLNCTGKESHVWRCP
SRGWGQHNCRHKQDAGVICSEFLALRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDITVS
MICRQLGCGDSGTLNSSVALREGFRPQWVDGIQCRKTDTSLWQCPSDPWNYTSCSPKEEA
YIWCADSRQIRLVDGGGRCSGRVEILDQGSWGTICDDRWDLDDARVVCRQLGCGEALDAT
ISSSFGRGSGPIWLDEVNCRGEESQVWRCPTWGWQQHNCDHQEDAGVICSGFVRLAGGDG
PCSGRVEVHSGEAWTPVSDGNFTLPTAQVICAELGCGKAVSVLGHMPFRESDGQVWAEEF
RCDGGEPELWSCPRVPCPGGTCLHSGAAQVVCSVYTEVQLMKNGTSQCEGQVEMKISGRW
RALCASHWSLANANVVCRQLGCGVAISTPRGPHLVEGGDQISTARFHCSGAESFLWSCPV
TALGGPDCSNGNTASVICSGNHTQVLPQCNDFLSQPAGSAASEESAPYCSEFLALRMVSE
DQQCAGWLEVFYNGTWGSVCRSPMEDITVSVICRQLGCGDSGSLNTSVGLREGSRPRWVD
LIQCRKMDTSLWQCPSGPWKYSSCSPKEEAYISCEGRRPKSCPTAAPCTDREKLRLREGD
SECSGRVEVWHSSSWGTVCDDSWSLAEAEVVCQQLGCGQALEAVRSAAFGPGNGSIWLDE
VQCGGRESSLWDCAAEPWGQSDCKHEEDAGVRCSGVRTTLPTTTAALSSYEDALAEAVYE
ELDYLLTQKEGLGSPDQTTDVPDENYDDAEEVPVPGTPSPSQGNEEEVPPEKEDGVRSSQ
TGSCLNFSREAADPGEEEESFWLLQGKKGDAGYDDVELSALGTSPMTFS
Download sequence
Identical sequences G5E6T1
ENSBTAP00000056494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]