SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056506 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056506
Domain Number 1 Region: 21-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.76e-56
Family L-arabinose binding protein-like 0.0046
Further Details:      
 
Domain Number 2 Region: 418-565,670-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-55
Family Phosphate binding protein-like 0.000000000089
Further Details:      
 
Domain Number 3 Region: 607-665,699-727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000523
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056506   Gene: ENSBTAG00000047202   Transcript: ENSBTAT00000065439
Sequence length 931
Comment pep:known_by_projection chromosome:UMD3.1:11:105922299:105945800:-1 gene:ENSBTAG00000047202 transcript:ENSBTAT00000065439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHVILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYESLDQLSYDHKRGPKAEKVLQFDPGTKNVTALLLEARELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
VDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLRPLRPRSPFGRFKV
NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANL
AAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNY
ESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQN
VSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLI
FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSF
KRRRSSKDTQYHPTDITGPLNLSDPSVSTVV
Download sequence
Identical sequences G3N3K3
ENSBTAP00000056506 ENSBTAP00000056506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]