SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056550 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056550
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily L domain-like 1.9e-21
Family U2A'-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056550   Gene: ENSBTAG00000011405   Transcript: ENSBTAT00000064971
Sequence length 622
Comment pep:known_by_projection chromosome:UMD3.1:20:71602439:71632615:-1 gene:ENSBTAG00000011405 transcript:ENSBTAT00000064971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAELQSLSIPGTYQEKITHLGNSLMNLTSLKSLDLSRNSLVSLEGIECLTALESLNLYYN
RISSLAEVFRLHSLAGLLDVDLRLNPVVKSEPDYRLFMVHMLPGLQQLDDRPVRESERRA
SRLHFGSEESLDSEQSFPSVFREERPHHSRVKCTDSSAKKCLVMDADDEAVLSLIAECEW
DLSNPPGGMSSSQKESEASLQTSQAESRHRLSPQSVQHQCGDSLWKGPERGRSSSRAGCV
EPRLQDQRCGELPPKSLHGSQPCRGKGIKPHTHQAPVTDSTETEDSGASSQKSSVSTQKM
LNPLPAPEKYRKRRMPGGRFQAPADEACLSCLEGSLSVSRRSSSEGWGQATSSLSATPGP
EQPRPPSASEGRKACPKLHSTALPGKKATLEALLLEALLDLVDRHWSGRRSLHSSEAFLA
QARHILSSVQEFTTTQDTSTTVNEEISSLTLENKSLHSRLTELQQQYGVKMTEVVLELSD
TRKEMDYLRQHLDRSLEESSSLKSLLLSMKKDVRTADAPSALNLQISGLQASMKRLSGEL
VELRQHLEHYDKIQELTQMLQESHSSLVRTNERLLQELDQVRAQHQAEVEQLHWSYKELK
KTLARFPGSPRDARPASPPRAL
Download sequence
Identical sequences G3N3P2
ENSBTAP00000056550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]