SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056581 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056581
Domain Number 1 Region: 109-307,351-512
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.4e-70
Family YicI catalytic domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.59e-21
Family YicI N-terminal domain-like 0.0053
Further Details:      
 
Domain Number 3 Region: 515-595
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.52e-19
Family Putative glucosidase YicI, domain 3 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056581   Gene: ENSBTAG00000046616   Transcript: ENSBTAT00000064122
Sequence length 647
Comment pep:novel chromosome:UMD3.1:4:106274880:106294491:1 gene:ENSBTAG00000046616 transcript:ENSBTAT00000064122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAYKKNSYGVHPYYMALE
EDGSAHGVLLLNSNAMADVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRP
AMIPYWALGFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQ
NLGPLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKWPDNSDIVWGKVWPD
LPNVNVDGSLDHETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYRNPREPEKSLKFDGL
WINMNEPSNFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCMESQQVLPDGSPVRH
YDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNRAAWDQLKKSI
IGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWD
SAFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEERTTWDIDHQFMLGP
AVLISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPLDHINLHIRGGYILP
WQEPAMNTYSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIVFNTGPL
Download sequence
Identical sequences G3N3S2
ENSBTAP00000056581 ENSBTAP00000056581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]