SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056590 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056590
Domain Number 1 Region: 933-1114
Classification Level Classification E-value
Superfamily Fibronectin type III 2.07e-20
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 625-694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000106
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 837-915
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000193
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 240-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000322
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 5 Region: 682-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000572
Family EGF-type module 0.005
Further Details:      
 
Domain Number 6 Region: 315-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.004
Further Details:      
 
Domain Number 7 Region: 717-833
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000534
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 8 Region: 583-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 549-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000443
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 512-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000005
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 360-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 472-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000057
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 13 Region: 280-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family EGF-type module 0.02
Further Details:      
 
Domain Number 14 Region: 200-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.006
Further Details:      
 
Domain Number 15 Region: 400-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000028
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056590   Gene: ENSBTAG00000014132   Transcript: ENSBTAT00000064553
Sequence length 1334
Comment pep:known_by_projection chromosome:UMD3.1:3:120761890:120804404:1 gene:ENSBTAG00000014132 transcript:ENSBTAT00000064553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYFREATDAATLRRAT
ADVRRYFPELPGFSATWVFVATWYRVTFFGGSASSPVNTFQTVLITDGTLSFTIFNYESI
TWTTGTHASSGGNASGLGGIAAQAGFNAGDGQRYFSIPGSRTADMAEVETTTNVGVPGRW
AFRIDDAQVRVGGCGHTTSVCQTLRPCLNGGKCIDDCVTGNPSYTCSCLSGFTGRTCHLD
VNECASHPCQNGGTCTHGVNSFSCQCPAGFRGPTCETAESPCDDRECQNGGWCRAEGGAA
ACVCPAGYTGAACETDVDECSSDPCLNGGSCVDLVGNFTCLCAEPFEGPRCETGHHPVSD
ACLSGPCQNGGTCVDADQGYVCECPEGFMGLDCRERTPSSCECRNGGRCLGANSSLCQCP
PGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHADHNVSHSLPSPCDSDPCF
NGGSCDAHEDSYTCECPRGFHGRHCEKARPRLCSSGPCRNGGTCKEAGGEYHCDCPYRFT
GRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGT
CEDLGTDFSCHCQAGYTGRRCQAEVDCGPPGEVQHATLRFNGTRLGSVALYLCDRGYSPS
ASSHVRVCQPQGVWSEPPQCHEIDECRSQPCLHGGSCQDRIAGYLCVCSPGREGTHCERE
TDKCQAQPCRNGGTCRDLPGASVCQCPPGFTGVHCETEVDACDSSPCQHGGRCENGGGAY
LCVCPEGFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGRDCDKELFPPTA
LKVEQVEESGVSISWRPPEGPAARQLLDGYAVTYVSSDGSYRRTDFVDRGRSAHQLRALA
PGRAYNVSVFSVKRNANNKNDISRPVVLLARTRPRPIEGLEVANVTASAISVRWALHRIR
HATVSSVRLSIRHPEAQEEQSTDVDRSVDRFTFRALLPGRRYAIWVTALSGLGGQERPTE
SLASAPVHVWTRPLPPANLTAARVTATSAHVVWDAPAPGASLEAYVINVTTSQSTKSRYV
PNGRLVSYTVRDLAPGRRYQLSVTAVQSTGGGQLHSEPAHLYIITLPPDGMARQGGSCKQ
ASQWRCQGGAELALPRQRPPSDPAAPPPSPWQPPLFPGLLKGAEGLKMPFIVKKAKLNSL
GHEEPRKPPLGFRRGPDPEICLRGPGQTGCGTEEGPRPCSPGLLTPLGPCWGHFGHWGWS
QSPGFRGLVHCPAACTKVPQPCTRLFSETKSMPVWEGGVCRHVYKRVYKVHPDTCFKESC
ESTRTRAPDRKQSN
Download sequence
Identical sequences G3N3S9
ENSBTAP00000056590 ENSBTAP00000056590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]