SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056638 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056638
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily L domain-like 4.87e-38
Family Internalin LRR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056638   Gene: ENSBTAG00000046046   Transcript: ENSBTAT00000065446
Sequence length 229
Comment pep:known chromosome:UMD3.1:24:40563771:40566586:1 gene:ENSBTAG00000046046 transcript:ENSBTAT00000065446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKLNLSHNQLRAVPPELGKLTRLVVLNLCGNRLKTLPGEVSLLQSLKVLFVHMNGLTEL
PAELGACRSLEVLSASHNCLSQLPTSLADLSRLRKLNLSHNRFAHIPVCVFSLKELDFLH
VGSNRLENIAESIQCLAGLQIFIAEGNHIHTFPRSLCLLTSLELLNLNNNDIQMLPAELY
MLCRLTRIAWNPMDKGLHISRNPLSKPLPELLEGGLEMLVSYLKDRKHT
Download sequence
Identical sequences A6QQH6
ENSBTAP00000056638 9913.ENSBTAP00000044444 9913.ENSBTAP00000044445 ENSBTAP00000056638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]