SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056645 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056645
Domain Number 1 Region: 1983-2283
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-125
Family BEACH domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 2404-2655
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.06e-30
Family WD40-repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 1886-1982
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-27
Family PreBEACH PH-like domain 0.0043
Further Details:      
 
Domain Number 4 Region: 11-559
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000691
Family Mo25 protein 0.06
Further Details:      
 
Domain Number 5 Region: 569-719
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000686
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056645   Gene: ENSBTAG00000014469   Transcript: ENSBTAT00000065285
Sequence length 2693
Comment pep:known chromosome:UMD3.1:2:91733811:91887415:1 gene:ENSBTAG00000014469 transcript:ENSBTAT00000065285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRERLFELWMLYCSKKDPDYLKLWLDSFVSSYEQFLDVDFEKLPTRVDDVPPGISLLP
DNILQVLRIQLLQCVQKMADGLEEEQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVI
TMTTLYIQQLKSKKKEKELADQTSIEEFVIHALAFCESLYDPYRNWRQRISGRIFSTVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQKNALQAISPATM
EVLMRVLADCDSWEDGNPEEVGRKVELTLKCLTEVVHILLTSSSDQRQVETSTILENYFK
LLNSDHSALPNQRRSRQWENRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKVFQGQLDYLAVSAIQALTAVMNKSPAAKEVFKERIGYTHMFEVLKSLGQPPLEL
LKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPELESHDLQVFISDWLKKICCINRQS
RTTCVNANMGIRIIEALNSHSCLHRTCAENLIALHGSLGSQSVSSEEIRQLLRLLRVDES
ESVHPYTTPVTRAILTMARKQSLESALQYFNLSHSMAGISVPSIQKWPGSAFSFNAWFCL
DQDQLTLGNANKGGKRKQLYSFFTGSGMGFEAFITHSGMLVVAVCTKREYATVMLPDHSF
CDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKVSAPLRFPAMNEPFISCCIGSAGQRTT
TPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGTTEKSKLITKLISAGTQDSEWGCPTS
LEGQLGSVIIFYEALQPPQVKALYLAGPNCLSPWKFQESDMADLPGNVLLHYTAKACKNA
ICLDLSTNCFHGRLTGNKVVNWDIKDVINCIGGLNVLFPLLEQISHFGEGQIPEGLNEST
VSELITPVEGDWVVLTSTKASESRLERNLIATFILIVKHFIQRHPINQDNLIHSHGVAVL
GALLQKVPSALMDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLFDFHIWNRGDFPFRIG
HIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGNDCKYNELSPDDIRTIRTSLYGLIKY
FLSKGGTHEEIQSIMGYIAAINEEEQLLGILDILFSLLRTSPNRGQLFLLLFEPGNADIL
YALLLNQKYSDKLREIIFKVMEQMLKCTNVYERSKQRIRLREVGYSGFGLLLNEAPVNTS
LIKSLTNQIINTDPAINFKDLLSVVYISHRAYINVRVVICRKMLQILQSQPDAAHQISQQ
VGWQDTLVKLFLKANFENGNTLHKHNRAIIVKDNDKNISVEDMKRSFDEKTDEEKIASFA
SAHVSSDEWSLEDRHSLDSNMPLFQEDSSMGELSFKSENQEEFWHNNPSPLSLDLSGIDS
CELSDGGSQMPDSLPSTPSPVESMKPFPVQPDKESSVTNDVGFSDDFSLLENKERCEEEL
IQLLTNILSCIMCKGLEKSDDDTWIERGQVFSALTKPGISSELLRPSDEIKLVLLQKMLE
WAVTENREAKMNPVTAENAFRLTLIIQDFLQSEGLVNSNMWTEKLLEDLMLLFDSLSVWY
SESPVGVKLSQIQIQLLLGFIGKGNLQVCAMASAKLNTLLQTKVIENQDEACYILGKLEH
VLSQSIKEQTEIYSFLIPLVRTLVSKIYELLFMNLHLPSLPLTNGSASFFEDFQEYCSSN
EWQVYIEKYIVPYMKKYETHTFYDSHESMALYWKDCYEALMVNMHKRDRDGGESKLKFQE
FFVEPFNRKVRQENLRYNNMLKQLSSQQLATLRRWKAVKLYLTCERGPWAKRQQNPIHWK
LANVENYSRMRLKLVPNYNFKTHEEASALRDNLGIQHSQPSSDSLLLEVVKQVKVSDMEE
DKLDLPEEEITSRVNIDEKEEQNQKEKLVLSEDCELITIIDVIPGRLEITTQHIYFYDGS
IEKEDGVGFDFKWPHSQVREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKVYSRLL
SLHSPNSYGTRSPQELFKASGLTQKWVNREISNFDYLIQLNTMAGRTYNDLAQYPVFPWI
LQDYTSEELDLNNPSVFRDLSKPIGVVNDKNAKATREKYENFEDPMGTIDKFHYGTHYSN
SAGVMHYLIRTEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFYF
PEFLENQNQFNLGRLQVSKELVNDVVLPKWAKSAEDFICKHRKALESEYVSAHLHEWIDL
IFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEPH
PSRLSAEEAVQKQAKTDTSTFNLFQHLPELKSFFIEGISDGIPLVKAIVPKNQSRSFMSQ
GSPELLITLSMNHIIGTHGWLPYDRNISNYFTFIRDQTVTNPKTQRSMNGPFAPGLEITS
KLFIVSHDAKLLFSAGHWDNSIQVMSLTKGKLISHNIRHMDIVTCLATDYCGIHLISGSR
DTTCMIWQITQQGGVPMGLASKPFQILYGHTDEVLSVAISTELDMAVSGSRDGTVIIHTI
QKGQYMRTLRPPCESSLLLTIPNLAISWEGHIVMYSSIEESTSLKDKNALHLFSVNGKYL
GSQVLKEQVSDICIIGEHIVTGSLQGFLSIRDLHSLNLCISPLAMRSPIHCVCVTKEYSH
ILVGLEDGKLIVVGVGRPAEMRSGQLSRKLWGSSKRLSQISAGETEYNTQDSK
Download sequence
Identical sequences G3N3Y1
ENSBTAP00000056645 ENSBTAP00000056645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]