SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001310 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001310
Domain Number 1 Region: 1210-1386
Classification Level Classification E-value
Superfamily AbfB domain 3.92e-21
Family AbfB domain 0.02
Further Details:      
 
Domain Number 2 Region: 874-938
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000343
Family ATI-like 0.03
Further Details:      
 
Domain Number 3 Region: 768-834
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000018
Family BSTI 0.033
Further Details:      
 
Domain Number 4 Region: 2367-2430
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000392
Family BSTI 0.041
Further Details:      
 
Domain Number 5 Region: 414-464
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000196
Family ATI-like 0.084
Further Details:      
 
Domain Number 6 Region: 937-977
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000816
Family VWC domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001310
Domain Number - Region: 1401-1455
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00139
Family BSTI 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001310   Gene: ENSBTAG00000000987   Transcript: ENSBTAT00000001310
Sequence length 2921
Comment pep:known_by_projection chromosome:UMD3.1:15:35409567:35496594:-1 gene:ENSBTAG00000000987 transcript:ENSBTAT00000001310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPAPVFCLLLACVWLPRGEPAGEFPPLQSLAAAATPRGNAELQPEPARDPSHSHQEAV
LAIGDATTVMGGQEEAEVLDSLAMSSWERRLHRAKCAPSYLFSCFNGGECVHPAFCDCRR
FNATGLRCQMVYNAGPERDSICRAWGQHHVETFDGLYYYLSGKGSYTLVGHHEPEGQIFS
VQVHNDPQCGSFPYTCSRSVSLFFAGEQEIHLAKEVTRGGVRLQLPHVMGNLRLQLLAGY
VLVRLQSAFTLAWDGTSAVYIKMSPEFLGWTHGLCGNNNADPQDDLVTSYGKLTDDVAEF
VHSWQEQAPNQPPGPTTSSLPRPPCLQQTPGTMQGVYDRCEALLRPPFDTCHAYVSPLPF
MASCTSDLCQSAGDEATWCRALAEYARACAQAGRPLQGWRNQLQSCTVLCKEKAFVYNEC
VACCPASCQPRASCVDSEIACVDGCYCPDGLIFEDGGCVAPAECPCEFHGTLYPTGSVVK
EDCNSCTCTAGRWVCSTSVCPAECSVTGDIHFTTFDGRRYTFPATCQYILAKSRSSGTFT
VMLQNAPCGLNQDGVCVQSVSVILHQDPRRQVTLTQAGDVLLFDQYKVTPPYTDDAFEIR
RLSSVFLRVRTNVGVRVLYDREGLRLYLQVDQRWVEDTVGLCGTFNGNTQDDFLSPVGVP
ESTPQLFGNSWKTLSACSPLVSGSRLDPCDVHLQAASFALQACSVLTGELFAPCSAYLSP
VPYFEQCRRDACRCGQPCLCATLAHYAHLCQRHGLPVDFRARLPGCALSCEATKEYSPCV
APCGQTCQDLAGPEACGVDGGSDLRGDECVEGCACPPDTYLDTQADLCVPRNHCSCHFQG
MDYPPGDSDVPTLGHCSCPQVSSLSPPSPLPAAACPAGQVFVNCSDLHADPELSRERTCE
QQLLNLSVPARGPCLSGCACPQGLLRHGDACFLPEECPCTWKGKEYYPGDQVMSPCHSCV
CQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKSTSDFSFSVIVENVN
CYSSGIICRKFISINVGNSLIIFDDDSGNPSPESFLDEKQQVHTWRAGFFTLVHFPREHI
TLLWDQRTTVHVQAGPQWQGQLAGLCGNFDLKTVNEMRTPENLELTNPQEFGGSWAAVEC
PDTLDPRDTCVLNPLREPFAKKECSVLLSEVFETCHPVVDVSWFYSNCLTDTCGCSRGGD
CECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCDFFNKALGKGPYQLASLAAGGALVAM
KVAGGALVLVRAEDVAPGDIVNFLLTAALYKAKAHDPDVVSLEAADRPNFFLHVTANGSL
ELAKWQADDAFRHHASFSLHRGTWRAGLVALESLAEPGAFLYVSGPVLALRPYEHTEAFR
WGTLFRLLDAKPSGAAYPTCEWHYDACASPCFQTCRDPWAAGCRDVPRVEGCVPACATPK
VLDEVTQRCVHLEDCVEPVDLVPREALGNETLPPGQALPTASDREPQFPQEAPGASSHRP
ALTPTAPLTTALNPPTAATVGPALSPGPAQATQQQLLGVTASNLPEHPTEAPASKGVTAG
HPASSGAPEPSSLPVSQHVPTSGMGSGAMETTRVTVILAESPNITVSSLSPPAPRFPLMT
KAVTVLGLGSLPVKTTPLQPFPSLELPASPSPAVTSRPPTSSGAREASLTPAMTKVMTET
GVPQSIQAQGPSSPSSPPAEARTAAEKIPAHTLVTESVETVPSPEKVQPGPDQPTGLPAA
PLPSPLPMASARPAQHATTAARPPAQPSGTAAAASLSTVAHSLGATPFTTLESTRPAQLL
SGLPPDTSLPLAKVGTSAPVATPGPKGSTLTPPLQQQATSLAVATTLPAGTLSPAPPLTL
AVVAQGHQPGHAVPQATGTAPGLLLGATLPTPGVVAVAEGVASTVSAAPRKSTTEKTVIL
SKQVSLPTWISGSAQGRPTELMPAVAHTAATLVMGAEGPWAGTVPLVPTSYPLSQVSART
ASRESPLILPPQLAEAHGTSAGPQPPAEPEGEATTQQSGRSAPAVQSVSAGSAEALAITA
EAKTPAACVPIAEQDCVRHICLQGELIRVNQSQHCPQGAAPPRCGVLGLAVRVGGDRCCP
IWECACRCSIFPDLSFVTFDGSHVALFKEAIYILSQRPEEMVTVHVLDCKSANLGHLNWP
PFCLVMLTVTHKTHEVTIDRFNRKVSVDSQPAWPPVSWHGFRIEDTGHMYVIRTPSHIQI
QWLHSSGLMILEASRASEAQGRGLCGICDGDVANDLTLKDGSVVSEAEDPAPFLDSWQVP
SSLTSVGQTRFRPDSCATADCSPCLRMVSNRTFSACHRFVPPESFCDLWIRDTKYVQQPC
VALTVYVAMCHKFHVCIEWRRSDHCPFLCSSDSTYQACVSACEPAKTCQDGMLGPLDPEQ
CQVLGEGCVCSEGTILHRRHSGLCIPEEKCACTDSTGMPRALGETWNSSLSGCCQHQCQA
PDTIVPVDLGCPGPRPESCPRFGEVALLQPTEDPCCLGTVCVCNQTLCEGLAPTCSPGHR
LLTHFQEDSCCPSYSCECDPDLCEAVQVPSCRQDQILITGRLGDSCCISYLCACGDCPDP
IPECQEGEALTVDRNTTELCCPLYQCVCESFRCAHVQCGMGTALVEVWSPERCCPYKSCE
CDCDTIPVPRCHLWEKSQLDEAFMRSAENVCGCAKYECVKAPVCLSRELGVMQPGQTVVE
LSADGVCHTSRCTDVLDPLTSFYQINTTSVLCDVHCEANQEYEHPRDLAACCGSCRNVSC
LFTFPNGTTSLFLPGASWIADCTRHHCSSTPLGAVLVRSPISCPPLNETECAKVGGSVVP
SLEGCCRTCKEDGRSCKKVTIRMTIRKNECRSNTPVNLVSCDGRCPSASIYNYNINTYAR
FCKCCREVGLQRRSVQLFCATNATWVPYTLQEPTDCACQWS
Download sequence
Identical sequences E1B8Y4
9913.ENSBTAP00000001310 ENSBTAP00000001310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]