SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001725 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001725
Domain Number 1 Region: 89-198
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.45e-36
Family Frataxin-like 0.000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001725   Gene: ENSBTAG00000001306   Transcript: ENSBTAT00000001725
Sequence length 217
Comment pep:known chromosome:UMD3.1:8:45503979:45528322:1 gene:ENSBTAG00000001306 transcript:ENSBTAT00000001725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRSVASFLPRSALPGFAPTRAGAPRPAKDLSLSGLPGLRIGTAKAPARSQSSLSL
RCLNQTLDVKKQSVCWINLRTAGTLGDAGTLDDTTYERLAEETLDSLAEFFEDLADKPYT
FEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGRNWVYSHDG
VSLHELLATELTQALKTKLDLSALAYSGKDTCCPAQC
Download sequence
Identical sequences Q05B87
ENSBTAP00000001725 NP_001074196.1.59421 NP_001074196.1.76553 XP_019821601.1.53367 ENSBTAP00000001725 9913.ENSBTAP00000001725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]