SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001818 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001818
Domain Number 1 Region: 522-554,654-729
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000408
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001818   Gene: ENSBTAG00000001382   Transcript: ENSBTAT00000001818
Sequence length 787
Comment pep:known_by_projection chromosome:UMD3.1:16:3479418:3498921:-1 gene:ENSBTAG00000001382 transcript:ENSBTAT00000001818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPLGEKLCSTFRCSSAKIKTTVFGLLPILS
WLPKYKIKDYIVPDILGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFRVFNTTTNESYVDTGAMEADRLHVSATLACLT
AVIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYAGPGSIVFT
FIDICKNLAHTNIASLIFALISGVVLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQPGFPTPVSPVVSQWKDMLGTAFSLAIVGYVINLAMGRTLANKHG
YDVDANQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVSSLCVSLVVMITML
VLGSYLYALPKSVLGALIAVNLKNSLKQLADPYYLWKKSKLDCCVWVVSFLSAFFLSLPY
GVAVGVTFSALVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVQEIQGIKIITYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKSLKKQEKGRTMPKQQRKSLFMKTKTVSLQELQQ
DFENGSPTDPNNNQTPANGASVSYITFSPDRSNAAHCEPPASAKPSDTLAGVPPFVTFHT
LILDMSGVSFVDLMGIKTLAKLSSTYEKIGVKVFLVNIHAQVYNDISHGGLFEDGCLERS
HVFPSIHDAVLFAQAQAAEVAPGHDFQEAPVDPELSLYEPEEDSPSYWDLEQEMFGSMFH
AETLTAL
Download sequence
Identical sequences E1B9J2
ENSBTAP00000001818 ENSBTAP00000001818 XP_010811351.1.76553 XP_010821323.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]