SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005578 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005578
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily TAFH domain-like 4.97e-33
Family TAFH domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 655-703
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000115
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005578   Gene: ENSBTAG00000004257   Transcript: ENSBTAT00000005578
Sequence length 806
Comment pep:known chromosome:UMD3.1:24:30850955:30957456:-1 gene:ENSBTAG00000004257 transcript:ENSBTAT00000005578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAGVGASGTVTMAPAAALPVRVESTPVALGAVTKAPVSVCVESSASQ
PLRSPVGTLVTKVAPVSALPKLSNGPRLPSPQIVAVKAPNTTTIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQAVTRTETTSNITSRPAVPANTQTVKICTMPNSSSQLIKKVAVAPVKQ
LAQVGTTVVTSVPKPSPVQSVAVPTNVVTVTPVKPVNTVTTLKPSSLGTASAPSNELNLK
TENSASAQANLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRQLYVELKSSPQPHLVPFLKKSVIALRQLMPNAQSFIQQCVQQTSSEVVTTTCPTT
STPSPVVTTAASSIQAEKPAVVGSEAGVPGVVSVQTLKPLAGPEGAKTGVVTLHSVGPAA
VPGGTTAGTVVLQTPKPLVTSLQNTVTAVSLQPEKPVVSGTAVTLALPSVPFGKTSAAAV
CIPSVKPILTSSGTTSNKPVLGPPLQIKLAQPGPVLAQPAGIPQAVKVKQLVVQQPSGGL
AKQVTTLTHSPALTIQKPGQKKVTVSTAIPTSQFSQASILKQVTLPGNKILSLQSSVQKN
KIKENGTISFSRDEDDINDVTSMAGVNLSEENACILATNSELVGTLIQSCKDEPFLFIGA
LQKRILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILS
NDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELA
QIQQRDANLTALAAIGPRKKRPLESG
Download sequence
Identical sequences E1BGK7
ENSBTAP00000005578 ENSBTAP00000005578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]