SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012245 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012245
Domain Number 1 Region: 528-560,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012245   Gene: ENSBTAG00000009296   Transcript: ENSBTAT00000012245
Sequence length 741
Comment pep:known_by_projection chromosome:UMD3.1:4:44826226:44862357:-1 gene:ENSBTAG00000009296 transcript:ENSBTAT00000012245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILGATKRYYVERPIFSHPVLQERLHKKDKVSDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHVSIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLHESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAFIMGARRKAMRKYAKEVGNANMANATVVKVDAEVD
GEDGTKPEEDENEIKYPPIVIKSTLPEELQRFMPPGDNIHTIILDFTQVNFIDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALLELLFHSIHDAVLGSQAREALA
EQEGSAVPPQEDSEPNATPEA
Download sequence
Identical sequences E1BHY0
ENSBTAP00000012245 NP_001179807.1.59421 NP_001179807.1.76553 XP_015324437.1.76553 ENSBTAP00000012245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]