SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018496
Domain Number 1 Region: 3963-4333
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-101
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 2 Region: 4470-4801
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-88
Family Hect, E3 ligase catalytic domain 0.0000392
Further Details:      
 
Domain Number 3 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-87
Family Regulator of chromosome condensation RCC1 0.0073
Further Details:      
 
Domain Number 4 Region: 2971-3262
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.53e-61
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 5 Region: 2740-2922
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2562-2637
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.12e-29
Family CPH domain 0.00079
Further Details:      
 
Domain Number 7 Region: 3213-3336
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1869-1935
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1210-1294
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.000000000000113
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018496
Domain Number - Region: 2468-2514
Classification Level Classification E-value
Superfamily UBA-like 0.000802
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3630-3720
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018496   Gene: ENSBTAG00000013916   Transcript: ENSBTAT00000018496
Sequence length 4847
Comment pep:known_by_projection chromosome:UMD3.1:2:646582:878049:-1 gene:ENSBTAG00000013916 transcript:ENSBTAT00000018496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELSQNGELPP
RKDDGVDTQIGTKKEDLNDKEKKEEEETPAPAYRAKSILESWVWGKQPDVNELKECLSVL
VKEQQALAIQSATTTLSALRLKQRLIVLERYFIALNRTVFQENVKVKWKSSNISLPPVDK
KSSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQ
RGALSQMLSAVLLLLHLWDSGTRETDNERSAQGTSAPLLPLLRRFRSIVCSKDGPCAEVD
THLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSVALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPSALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMTVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVALASSAGVLSTVQAAAQAVLQSGWSVLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESVGQTSEISS
PELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGDFTGILLPELVV
SIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDLEELAWPGIMVYTESFF
TGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFVGED
PVVALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLH
ASYLAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSR
LCSHRQALGDHAQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEV
GRLLLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQ
EQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWKRIAQKIIRERRK
KRDIVPKKPESTEEEEKIGNGESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVT
GVHRYKWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDT
ILKLAAKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGK
LYTWAVQNIRNVLIDANTKFKELGIQPVPLQTITNENPSGPSLGTTPQARFLLVMLSMLT
LQHGAHNLSLLLNSGTLALTQTALRLIGPSCDNVEEDMNASARGASATVLEETRKETAPV
QLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTN
SYRMGKEGKYDLKLAELPVSTQPSAEDSDTEDDSEAEQIERNIHPTAMMLTSTVNLLQTL
CLSAGVHAEVMQSEATKTLCGLLRMLVESGTTDKTSSPSRLVCREQHRSWCTLGFVRSIA
LTPHMCAALSSPPWISLLVKVVEGHSPFTAASLQRQILAVHLLQAVLPSWDKTERARDME
CLVEKLFGFLGSLLTTCSSDVPFLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLH
SLGQWNGLINKYINSQLHSVTRSCAGKPAEGALLDDYFPDCENPEVGSLMAVLAVIGGID
GRLRLGGQVMHDDFGEGTVTRITPKGKITVQFCDLRTCRVCPLNQLKPLPAVAFSVTNLP
FTEPMLSVWAQLVNLAGSKLEKHKIKKSPKQGFAGQVDLDLLRCQQLKLYILKAGRALLS
HQDQLRQILSQPAVQEAAAAHTDSDDGAAVSPDLVDMSPEGPQPPMILLQQLLASATQPS
PVKAIFDKQELEAAALAVCQCLAVESTHPLSPVFEDCSSSEATTPVPVQHIRPVRAKKHK
QSPGPVLPIVVQLMEMGFPRRNIEFALKSLTGASGNAAGLPGVEALVGWLLDHADVQVTD
LSDADTGSEECSDEEVVEDVDDTAYAMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQ
VGMMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIESLG
YPPPSSPSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDFPQQSHW
TGLLSEMELVPSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCEACFKTRKHNTRHTFGR
INEPGQSAIFCGRSGKQLKRCHNSQPGMLLDSWARMVKSLNVSSSVNQASRLIDGSEPCW
QSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININ
PTDTTVSLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDMAAVPFLASD
NEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETL
SALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKK
VAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSS
HSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALT
DEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTW
GKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQ
GNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGA
SYLGVPSDADSSPASNKINGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYA
RDTVVGALMPAGMVAPVECPSFSSSAPASDVSAMASPMNGEECVLAVDIEDRLSPNPWQE
KRGEIISSEDAVTPSAVTPSACSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKVS
GPELQSLDEFTSLLVVDDTRVLVDLLKLSVCGRAGDKGRDVLSAVLSGMGTAYPQVADML
LELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCS
TERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVY
PIMPAAGPKDLLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIIPRLAASLAACAQLSALA
ASHRMWALQRLRKLLTTEFGQSININRLLGDNDGETRALSFSGSALAALVKGLPEALQRQ
FEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVAL
DKRTSLPRLFLDEVAKKIRELMADGENMDVLHESHSIFRREQDEQLVQWMNRRPDDWTLS
AGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALAALRPVQLIGGEQTLFAVTADGKLY
ATGYGAGGRLGVGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAE
DGKLGHGNRSPCDRPRVIESLRGTEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSD
SEDQLKPKLVEALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKV
PMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQ
GKKVIAIATGSLHCVCCSEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVA
CGSAHTLAWSTSKPASAGKLPVQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMF
DLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKR
SRSKGGLAGPDGTKSVFGQMCAKMTSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIA
EICEELQNGLTPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGIAIRTG
SPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPS
ASGQDIQLSSKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTG
YELETMVCGSPDIPLHLLKSVATYKGVEPSAPLIQWFWEVMESFSNTERSLFLRFVWGRT
RLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHF
CKSIDTDDYARIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences E1B782
ENSBTAP00000018496 ENSBTAP00000018496 9913.ENSBTAP00000018496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]