SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022931 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022931
Domain Number 1 Region: 546-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000135
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022931   Gene: ENSBTAG00000017251   Transcript: ENSBTAT00000022931
Sequence length 960
Comment pep:known_by_projection chromosome:UMD3.1:23:9853166:9942504:-1 gene:ENSBTAG00000017251 transcript:ENSBTAT00000022931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDRSFQSFASRYRQSSFTYDVKRDVYNEENFQQEHRKKTASSGNVDIDISTVSHHVQC
RCSWHKFRRCLLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQIPQVLMLGLLARHLIP
PLNVSYAAFCASVIYGIFGSCHQMSIGTFFLVSALAINVLRTQPFNRGHLLLGTFIQADF
SNTSFYENYNRSLSSVASVTLLTGIIQLSMGMLGFGFIVAYIPEAAISAYLAATALHVML
SQLTCIFGIMISYNSGPIAFFYNIINYCLGLPKANSTSILLFLTAMVALRINKCIRISFN
QYPIEFPMEVFLVLGFAAFSNKVNMATENSLMLMEMIPYSFLFPVTPDMSNLTEVLIESF
SLALVSSSLLVFLGKKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVARTIIQD
KTGGRQQFASLVGAGIMLLLMMKMARFFYRLPNAIVAGIILSNVLPYLEAVYTLPSLWRQ
NQYDCLIWMVTFMSAILLGLDIGLVVAVTFAFFIITVQSHRTKILLLGQIPNTNIYRSFQ
DYREVANIPGVKIFQCCNAITFVNVHYLKRKVLEEIEMVKMPLTEEEIYTLFSQNEEGAQ
RGKICRCYCNCDEPEPSPRVIYTERYEVQRGRESSFINLVRCSRFESMNTAQTMSEDQVP
YITSSSSQRNPNYEEVEKVWLSDDPSRSMTITLPEASDTQVRATKLLPYSTSTILPSIHT
IILDFSMVHLVDARALVVLRQMFSAFQNANILVLIAGCHSFVVRSLEKNDFFDAGITKAQ
LFLTLHDAVLFALSRKLPESSELSVDESETVIQETFSETDKKEESRHKTNRSLIEAPRSK
SPGFSLLPDPEMEEESDLDLYSTIQMSKDHGLDLDLDLDREVEPESELEPESELDQETEL
EPEPEASPKPNRQKYWSLFRAIIPRSPTQTQARTQSVDRRHQNVKPYTSKADTSEDALEI
Download sequence
Identical sequences F1MEY3
XP_005223393.1.76553 ENSBTAP00000022931 ENSBTAP00000022931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]