SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027245 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027245
Domain Number 1 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.53e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-17
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 4 Region: 434-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 393-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000107
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027245
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.014
Further Details:      
 
Domain Number - Region: 339-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0145
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027245   Gene: ENSBTAG00000020445   Transcript: ENSBTAT00000027245
Sequence length 640
Comment pep:known_by_projection chromosome:UMD3.1:4:113049658:113071436:1 gene:ENSBTAG00000020445 transcript:ENSBTAT00000027245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAPTSEWDSECLTSLQALPLPAAPAANEAHLQTAAISLWTVVAAVQAIERKVEVH
SRRLLHLEGRTGTAEKKLASCEKTVADLGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWILRLPPGIKGDIPKVPVTFDDISIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SMDYAMNQPDVLSQIQPEGDRNTEDQTGPEESGIPTDPSEEPGISTSDILSWIKQEEETQ
VGAPQEPKESDMCKGTYADEELVIKAEGLARASLCPEVPVAFSSPAAAAKEPFPDMAFKS
PQSAPLAPFGRPAADLAEASEGQVTFTQLGTYPLPPPAGEPVFSCHHCGKSLSQDLLLTH
QCGPPGEHAAPCAQCPKHLPTPADGGPPAPARETPPTCPHCARTFTHPSRLTYHLRVHNS
AERPFPCPDCPKRFADQARLASHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQERP
FSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCT
HCGKSFIRKHHLMKHQRIHTGERPYPCAQCGRSFRYKQTLKDHLRAGHGGGCGGDRDPSG
PPPDPPGPLLPGLEASGLGVNPEGLEANQWYGEGSGGAVL
Download sequence
Identical sequences E1BNM7
ENSBTAP00000027245 9913.ENSBTAP00000027245 NP_001192847.1.59421 NP_001192847.1.76553 ENSBTAP00000027245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]