SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027426 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027426
Domain Number 1 Region: 2-568
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.22e-82
Family Acetyl-CoA synthetase-like 0.0000391
Further Details:      
 
Domain Number 2 Region: 751-1101
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0082
Further Details:      
 
Domain Number 3 Region: 554-609
Classification Level Classification E-value
Superfamily ACP-like 0.0000157
Family Peptidyl carrier domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027426   Gene: ENSBTAG00000020583   Transcript: ENSBTAT00000027426
Sequence length 1106
Comment pep:known_by_projection chromosome:UMD3.1:6:73409452:73435649:-1 gene:ENSBTAG00000020583 transcript:ENSBTAT00000027426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQAASLYSDKIAVCFDECNNQPPVYYTYKTVIHAASALSNFLLLHCEFQGIRE
IGLYCHPTINLPSWILGILQVPAAYVPVDPDSPPALSVHFMKKCNLKYILVEKVHISKFK
SSYEALLNYDMLKVEHNDLVLFRLHWKNVEVSLVLNDRKEKYEKGKMPKSMHSESSSEEK
SEEHMDMRQKHCLAYVLHTSGTTGIPKIVRVPHACIVPNIQHFRVLFEITHEDVLFLASP
LTFDPSVVEIFVALSSGASLLIVPTSVKMVPSKLAAVLFSHHRVTILQATPTLLRRFGSQ
LIKSTVLSASTSLRILALGGEAFPSLTVLKSWRGVGNKTQIFNIYGITEVSSWATFYRIP
EKILNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGNGQVFLGGRNRVCFLDGEVTVP
LGTMRATGDFVTIKDGEIFFLGRKDSQIKRHGKRLNIELVQQIAEGLQQVESCAVTWYNQ
EKLILFMVTKNDLVKDHIFEELQKHLPSHAIPDELVLINSLPFTSHGKIDVSELNKIYLN
YRDLKSECKLSGKEELWEKLHHLWKSVLSLSEDALKIPDESLFLNSGGDSLKSIRLLNEI
ENLVGTSVPGLLEIILSSSILRIYNHILQTVFSDKDMTLSKNHAMKRKFNVTQEETSGKS
LHQETVMPLNCDKEIDAFIALSRGNQILSLNTDKYLTKLGHCPSTYSSDLNSQTDIQNRE
SLNTPPLIGKSEDPSCVVEVSEEETPVIRAEKMEFRVRWRSDTGKCVDASPLVVIPAIDK
SSATVYIGSHSHRMIAVDLYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVLK
SNSGEKYWMFSTEDAVKSSATMDPTTGLLYIGSHDQHAYALDIYKKKCVWKLKCGGTVFS
SPCLSLIPSHLYFATLGGLLLAINPATGDRLWKHSCGKPLFSSPRCCLQYVFIGCVDGNL
LCFTHFGEQVWQFSTNEPIFSSPCTSASEQEIFFGSHDCFIYCCSMKGHLQWKFETTSRV
YSTPFVFRNHNHNSEMLLAAASTDGKLWILESKSGQLQSVYELPGEVFSSPVVWESMLII
GCRNNYVYCLDVLGDKGNEVQSLEYT
Download sequence
Identical sequences E1BCU3
9913.ENSBTAP00000027426 ENSBTAP00000027426 ENSBTAP00000027426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]